Sort-Tagged Drosophila Cryptochrome. Determined by X-ray diffraction at 2.58 Å resolution. Released 5 May 2021.
Explore 6WTB in 3D Show helices and sheets RCSB PDB PDBe
6WTB contains 69 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-11 | 7 | 1 |
| α-helix | 21-26 | 6 | |
| α-helix | 27-32 | 6 | |
| β-strand | 34-41 | 8 | 1 |
| α-helix | 54-73 | 20 | |
| β-strand | 82-84 | 3 | 1 |
| α-helix | 88-98 | 11 | |
| β-strand | 101-107 | 7 | 1 |
| α-helix | 112-114 | 3 | |
| α-helix | 115-128 | 14 | |
| β-strand | 131-135 | 5 | 1 |
| α-helix | 143-149 | 7 | |
| α-helix | 158-168 | 11 | |
| α-helix | 171-174 | 4 | |
| α-helix | 176-178 | 3 | |
| β-strand | 185 | 1 | 1 |
| α-helix | 190-195 | 6 | |
| α-helix | 202-204 | 3 | |
| α-helix | 205-208 | 4 | |
| α-helix | 227-247 | 21 | |
| α-helix | 252-255 | 4 | |
| α-helix | 267-272 | 6 | |
| α-helix | 277-288 | 12 | |
| β-strand | 296 | 1 | 2 |
| β-strand | 301 | 1 | 2 |
| α-helix | 303-305 | 3 | |
| α-helix | 306-321 | 16 | |
| α-helix | 342-345 | 4 | |
| α-helix | 347-355 | 9 | |
| α-helix | 361-372 | 12 | |
| α-helix | 378-388 | 11 | |
| α-helix | 397-407 | 11 | |
| α-helix | 413-424 | 12 | |
| α-helix | 430-433 | 4 | |
| α-helix | 440-447 | 8 | |
| α-helix | 452-457 | 6 | |
| α-helix | 459-461 | 3 | |
| α-helix | 466-469 | 4 | |
| α-helix | 472-474 | 3 | |
| α-helix | 479-482 | 4 | |
| β-strand | 487 | 1 | 3 |
| β-strand | 491 | 1 | 3 |
| α-helix | 492-494 | 3 | |
| α-helix | 498-515 | 18 | |
| α-helix | 528-534 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-11 | 6 | 4 |
| α-helix | 21-26 | 6 | |
| β-strand | 35-41 | 7 | 4 |
| α-helix | 46-48 | 3 | |
| α-helix | 54-73 | 20 | |
| β-strand | 82-84 | 3 | 4 |
| α-helix | 88-98 | 11 | |
| β-strand | 101-107 | 7 | 4 |
| α-helix | 112-114 | 3 | |
| α-helix | 115-128 | 14 | |
| β-strand | 131-135 | 5 | 4 |
| α-helix | 143-149 | 7 | |
| α-helix | 158-168 | 11 | |
| α-helix | 171-179 | 9 | |
| α-helix | 190-195 | 6 | |
| α-helix | 205-208 | 4 | |
| β-strand | 213 | 1 | 5 |
| β-strand | 216 | 1 | 5 |
| α-helix | 227-247 | 21 | |
| α-helix | 252-255 | 4 | |
| α-helix | 267-271 | 5 | |
| α-helix | 277-288 | 12 | |
| β-strand | 296 | 1 | 6 |
| β-strand | 301 | 1 | 6 |
| α-helix | 303-305 | 3 | |
| α-helix | 306-321 | 16 | |
| α-helix | 326-329 | 4 | |
| α-helix | 342-344 | 3 | |
| α-helix | 347-354 | 8 | |
| α-helix | 361-372 | 12 | |
| α-helix | 378-388 | 11 | |
| α-helix | 398-407 | 10 | |
| α-helix | 413-424 | 12 | |
| α-helix | 430-433 | 4 | |
| α-helix | 440-447 | 8 | |
| α-helix | 452-457 | 6 | |
| α-helix | 459-461 | 3 | |
| α-helix | 466-468 | 3 | |
| α-helix | 472-474 | 3 | |
| α-helix | 477-482 | 6 | |
| β-strand | 487 | 1 | 7 |
| β-strand | 491 | 1 | 7 |
| α-helix | 492-494 | 3 | |
| α-helix | 498-515 | 18 | |
| α-helix | 528-534 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cryptochrome-1 | A, B | protein | 593 | Drosophila melanogaster | O77059 (AlphaFold model) |
>6WTB_1 Cryptochrome-1 (chains A, B) MGSSWSHPQFEKGGGSGGGSGGSAWSHPQFEKGGENLYFQSGGHMMATRGANVIWFRHGL RLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAAT DGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEK VSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRS LKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQA LPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWR EYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGW LHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSS LVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERI IDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLADLPGTGGGGC
Tuning flavin environment to detect and control light-induced conformational switching in Drosophila cryptochrome. Chandrasekaran, S., Schneps, C.M., Dunleavy, R. et al. Commun Biol (2021) 4:249-249. DOI 10.1038/s42003-021-01766-2 · PubMed
Other PDB entries of the same protein (UniProt O77059 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6WTB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.