4KVC: 2H2 Fab fragment of immature Dengue virus

2H2 Fab fragment of immature Dengue virus. Determined by X-ray diffraction at 2.31 Å resolution. Released 24 Jul 2013.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,461
Mol. weight: 47.07 kDa
Released: 24 Jul 2013

Explore 4KVC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KVC contains 16 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	33-40	8	2
β-strand	43-51	9	2
β-strand	58-60	3	2
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-100	9	2
β-strand	106-110	5	2
β-strand	114-118	5	2
α-helix	121-123	3
β-strand	124	1	3
α-helix	125-126	2
β-strand	127-131	5	4
β-strand	142-152	11	4
β-strand	153	1	3
β-strand	158-161	4	5
α-helix	162-164	3
β-strand	166	1	5
β-strand	171-172	2	4
α-helix	173-175	3
β-strand	176-178	3	4
β-strand	181-191	11	4
α-helix	192-194	3
β-strand	201-206	6	5
α-helix	207-209	3
β-strand	211-216	6	5

Chain L: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	18-29	12	6
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
β-strand	62-76	15	6
α-helix	80-82	3
β-strand	84-90	7	7
α-helix	96	1
β-strand	97-98	2	7
β-strand	102-106	5	7
β-strand	111	1	8
α-helix	112-113	2
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	144-150	7	10
β-strand	153-155	3	10
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-186	4
β-strand	191-198	8	10
α-helix	204	1
β-strand	205-210	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig heavy chain V region MOPC 21, Igh protein	H	protein	220	Mus musculus	P01865 (AlphaFold model)
Ig kappa chain V-V region MOPC 21, Anti-colorectal carcinoma light chain	L	protein	212	Mus musculus	P01837 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>4KVC_1 Ig heavy chain V region MOPC 21, Igh protein (chains H)
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHY
ADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARWGNYPHYAMDYWGQGTSVTVSS
AKTTAPSVYPLAPVCDGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Sequence of entity 2 (L), FASTA

>4KVC_2 Ig kappa chain V-V region MOPC 21, Anti-colorectal carcinoma light chain (chains L)
NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Primary citation

Obstruction of Dengue Virus Maturation by Fab Fragments of the 2H2 Antibody. Wang, Z., Li, L., Pennington, J.G. et al. J Virol (2013) 87:8909-8915. DOI 10.1128/JVI.00472-13 · PubMed

Other PDB entries of the same protein (UniProt P01865 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NCW 1.3 Å, Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid
1RUK 1.4 Å, Crystal structure (C) of native cationic cyclization antibody 4C6 fab at pH 4.6 with a…
1RUP 1.4 Å, Crystal structure (G) of native cationic cyclization antibody 4C6 fab at pH 8.5 with a…
1RUM 1.48 Å, Crystal structure (F) of H2O2-soaked cationic cyclization antibody 4C6 fab at pH 8.5…
1RUA 1.75 Å, Crystal structure (B) of u.v.-irradiated cationic cyclization antibody 4C6 fab at pH 4.6…
1NBY 1.8 Å, Crystal Structure of HyHEL-63 complexed with HEL mutant K96A
1FLR 1.85 Å, 4-4-20 FAB fragment
6UQC 1.87 Å, Mouse IgG2a Bispecific Fc
1RUL 1.88 Å, Crystal Structure (D) of u.v.-irradiated cationic cyclization antibody 4C6 Fab at pH 5.6…
1NDG 1.9 Å, Crystal structure of Fab fragment of antibody HyHEL-8 complexed with its antigen lysozyme
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3FO9 1.9 Å, Crystal structure of aldolase antibody 33F12 Fab' in complex with hapten 1,3-diketone

Browse structure collections

About this viewer

MolViewer shows 4KVC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.