4L0N: STK3 (MST2) SARAH domain
Crystal structure of STK3 (MST2) SARAH domain. Determined by X-ray diffraction at 1.4 Å resolution. Released 19 Jun 2013.
- Method
- X-ray diffraction
- Resolution
- 1.4 Å
- Organism
- Homo sapiens
- Chains
- 10
- Atoms
- 5,292
- Mol. weight
- 61.68 kDa
- Released
- 19 Jun 2013
Explore 4L0N in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4L0N contains 19 α-helices and 0 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 0-440 | 6 | |
| α-helix | 445-483 | 39 | |
Chain B: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 0-442 | 8 | |
| α-helix | 445-482 | 38 | |
Chains C and E: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 437-440 | 4 | |
| α-helix | 445-482 | 38 | |
Chains D, F, H and I: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 0-440 | 6 | |
| α-helix | 445-482 | 38 | |
Chain G: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 436-440 | 5 | |
| α-helix | 445-482 | 38 | |
Chain J: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 445-483 | 39 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Serine/threonine-protein kinase 3 | A, B, C, D, E, F, G, H, I, J | protein | 51 | Homo sapiens | Q13188 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA
>4L0N_1 Serine/threonine-protein kinase 3 (chains A, B, C, D, E, F, G, H, I, J)
SMDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAK
Primary citation
Crystal structure of STK3 (MST2) SARAH domain. Chaikuad, A., Krojer, T., Newman, J.A. et al. To be published.
Other PDB entries of the same protein (UniProt Q13188 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4HKD 1.5 Å, Crystal structure of human MST2 SARAH domain
- 6AR2 1.55 Å, Structure of human SLMAP FHA domain in complex with pMST2
- 4OH9 1.7 Å, Crystal Structure of the human MST2 SARAH homodimer
- 8A66 1.9 Å, Crystal structure of MST2 in complex with XMU-MP-1
- 3WWS 2.01 Å, Crystal structure of Serine/threonine-protein kinase 3
- 4LG4 2.42 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5
- 5DH3 2.47 Å, Crystal structure of MST2 in complex with XMU-MP-1
- 5BRM 2.65 Å, Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in…
- 6AO5 2.96 Å, Crystal structure of human MST2 in complex with SAV1 SARAH domain
- 4LGD 3.05 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5
Browse structure collections
About this viewer
MolViewer shows 4L0N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.