8A66: MST2

Crystal structure of MST2 in complex with XMU-MP-1. Determined by X-ray diffraction at 1.9 Å resolution. Released 20 Jul 2022.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,757
Mol. weight: 68.89 kDa
Ligands: 5BS
Released: 20 Jul 2022

Explore 8A66 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8A66 contains 41 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	129-134	6	1
α-helix	135	1
β-strand	143-148	6	1
β-strand	154-160	7	1
α-helix	166-177	12
β-strand	184	1	2
α-helix	185-186	2
β-strand	187-193	7	1
β-strand	196-202	7	1
β-strand	207-208	2	2
α-helix	209-216	8
α-helix	219-221	3
α-helix	222-241	20
β-strand	244-245	2	3
α-helix	251-253	3
β-strand	254-256	3	2
β-strand	262-264	3	2
β-strand	271-272	2	3
β-strand	280	1	4
α-helix	287-289	3
α-helix	292-295	4
β-strand	300	1	4
α-helix	304-318	15
α-helix	328-334	7
α-helix	339-341	3
α-helix	346-348	3
α-helix	351-360	10
α-helix	365-367	3
α-helix	369-370	2
α-helix	371-374	4
α-helix	378-381	4
α-helix	383-385	3
α-helix	386-389	4
α-helix	390-404	15

Chain B: 20 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	125-128	4
β-strand	129-136	8	5
β-strand	143-148	6	5
β-strand	153-160	8	5
α-helix	166-178	13
β-strand	184	1	6
β-strand	187-193	7	5
β-strand	196-202	7	5
β-strand	207-208	2	6
α-helix	209-216	8
α-helix	219-221	3
α-helix	222-241	20
β-strand	244-245	2	7
α-helix	251-253	3
β-strand	254-256	3	6
β-strand	262-264	3	6
β-strand	271-272	2	7
β-strand	281	1	8
α-helix	288-290	3
α-helix	293-296	4
β-strand	301	1	8
α-helix	305-319	15
α-helix	329-335	7
α-helix	340-342	3
α-helix	347-349	3
α-helix	352-361	10
α-helix	366-368	3
α-helix	370-371	2
α-helix	373-376	4
α-helix	380-383	4
α-helix	385-387	3
α-helix	388-391	4
α-helix	392-407	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 3 36kDa subunit	A	protein	298	Homo sapiens	Q13188 (AlphaFold model)
Serine/threonine-protein kinase 3 36kDa subunit	B	protein	298	Homo sapiens	Q13188 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8A66_1 Serine/threonine-protein kinase 3 36kDa subunit (chains A)
GEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIM
QQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGL
EYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQ
EIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDF
VKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEE

Sequence of entity 2 (B), FASTA

>8A66_2 Serine/threonine-protein kinase 3 36kDa subunit (chains B)
GEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIM
QQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGL
EYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQ
EIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDF
VKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEE

Ligands and cofactors

ID	Name	Formula	Copies
5BS	4-[(5,10-dimethyl-6-oxo-6,10-dihydro-5H-pyrimido[5,4-b]thieno[3,2-e][1,4]diazep…	C17 H16 N6 O3 S2	2

Water and common crystallization additives (NA) are not listed.

Primary citation

Crystal structure of the Kelch domain of human Keap1in complex with ligand S217879. Weber, C., Vuillard, L., Delerive, P. et al. To be published.

Other PDB entries of the same protein (UniProt Q13188 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4L0N 1.4 Å, Crystal structure of STK3 (MST2) SARAH domain
4HKD 1.5 Å, Crystal structure of human MST2 SARAH domain
6AR2 1.55 Å, Structure of human SLMAP FHA domain in complex with pMST2
4OH9 1.7 Å, Crystal Structure of the human MST2 SARAH homodimer
3WWS 2.01 Å, Crystal structure of Serine/threonine-protein kinase 3
4LG4 2.42 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5
5DH3 2.47 Å, Crystal structure of MST2 in complex with XMU-MP-1
5BRM 2.65 Å, Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in…
6AO5 2.96 Å, Crystal structure of human MST2 in complex with SAV1 SARAH domain
4LGD 3.05 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5

Browse structure collections

About this viewer

MolViewer shows 8A66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.