4LG4: Serine/threonine-protein kinase 3

Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5. Determined by X-ray diffraction at 2.42 Å resolution. Released 18 Sept 2013.

Method

X-ray diffraction

Resolution

2.42 Å

Organism

Homo sapiens

Chains

6

Atoms

13,447

Mol. weight

204.2 kDa

Released

18 Sept 2013

Explore 4LG4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LG4 contains 123 α-helices and 53 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 9 β-strands

Molecules and chains

>4LG4_1 Serine/threonine-protein kinase 3 (chains A, B, C, D, E, F)
GEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIM
QQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGL
EYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQ
EIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDF
VKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE

Primary citation

Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5. Ni, L., Li, S., Yu, J. et al. Structure (2013) 21:1757-1768. DOI 10.1016/j.str.2013.07.008 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q13188 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 4L0N 1.4 Å, Crystal structure of STK3 (MST2) SARAH domain
• 4HKD 1.5 Å, Crystal structure of human MST2 SARAH domain
• 6AR2 1.55 Å, Structure of human SLMAP FHA domain in complex with pMST2
• 4OH9 1.7 Å, Crystal Structure of the human MST2 SARAH homodimer
• 8A66 1.9 Å, Crystal structure of MST2 in complex with XMU-MP-1
• 3WWS 2.01 Å, Crystal structure of Serine/threonine-protein kinase 3
• 5DH3 2.47 Å, Crystal structure of MST2 in complex with XMU-MP-1
• 5BRM 2.65 Å, Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in…
• 6AO5 2.96 Å, Crystal structure of human MST2 in complex with SAV1 SARAH domain
• 4LGD 3.05 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5

Browse structure collections

About this viewer

MolViewer shows 4LG4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.