4L8S: Human Valpha7.2/Vbeta13.3 MAIT TCR

Crystal structure of a human Valpha7.2/Vbeta13.3 MAIT TCR in complex with bovine MR1. Determined by X-ray diffraction at 2.9 Å resolution. Released 16 Oct 2013.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Homo sapiens, Bos taurus
Chains: 3
Atoms: 6,344
Mol. weight: 97.29 kDa
Released: 16 Oct 2013

Explore 4L8S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4L8S contains 21 α-helices and 77 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	9-13	5	2
β-strand	18-24	7	1
β-strand	31-37	7	2
β-strand	44-49	6	2
β-strand	53-57	5	1
β-strand	60-65	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-91	8	2
β-strand	97-99	3	2
α-helix	100-101	2
β-strand	103-108	6	2
β-strand	117-120	4	3
α-helix	121-123	3
β-strand	130-135	6	3
β-strand	142	1	4
β-strand	152-154	3	3
β-strand	158-159	2	5
β-strand	170-175	6	3
β-strand	190	1	4
β-strand	196	1	3

Chain B: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-14	5	7
β-strand	19-21	3	8
β-strand	22-25	4	6
β-strand	31-37	7	7
β-strand	44-49	6	7
β-strand	56-57	2	7
β-strand	65-68	4	8
β-strand	73	1	6
β-strand	74-78	5	8
α-helix	83-85	3
β-strand	87-94	8	7
α-helix	103	1
β-strand	104-105	2	7
β-strand	109-114	6	7
α-helix	117-119	3
β-strand	121	1	9
α-helix	122-123	2
β-strand	124-128	5	5
α-helix	129-131	3
α-helix	132-138	7
β-strand	140-150	11	5
β-strand	151	1	9
β-strand	155-161	7	10
β-strand	164-166	3	10
β-strand	170-172	3	5
β-strand	177-178	2	5
β-strand	188-197	10	5
α-helix	198-201	4
β-strand	207-214	8	10
β-strand	217	1	11
α-helix	228-229	2
β-strand	231	1	11
β-strand	233-240	8	10

Chain C: 10 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	12
α-helix	4-5	2
β-strand	6-11	6	13
β-strand	23-30	8	13
β-strand	31	1	12
β-strand	36-41	6	14
β-strand	44-46	3	14
β-strand	48-50	3	13
α-helix	51-53	3
β-strand	54-55	2	13
β-strand	61-67	7	13
β-strand	77-82	6	14
α-helix	89	1
β-strand	90-93	4	14
β-strand	117-126	10	15
β-strand	136-142	7	15
β-strand	145-147	3	15
β-strand	148	1	16
β-strand	149-151	3	15
β-strand	159	1	16
α-helix	162-167	6
α-helix	170-197	28
β-strand	205-214	10	15
β-strand	220-228	9	15
β-strand	231-237	7	15
β-strand	242-245	4	15
α-helix	248-257	10
α-helix	261-269	9
α-helix	270-274	5
α-helix	275-285	11
α-helix	287-290	4
β-strand	294	1	17
β-strand	297-303	7	18
β-strand	310-319	10	18
β-strand	320	1	17
β-strand	325-330	6	19
β-strand	333-334	2	19
β-strand	339-341	3	18
β-strand	345-346	2	18
β-strand	352-360	9	18
β-strand	367-373	7	19
β-strand	378-385	8	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muccosal Associated Invariant T Cell Receptor alpha chain	A	protein	208	Homo sapiens	Q6P4G7 (AlphaFold model)
Muccosal Associated Invariant T Cell Receptor beta chain	B	protein	252	Homo sapiens
Beta-2-microglobulin, MHC class I-related protein	C	protein	392	Bos taurus	C1ITJ8 (AlphaFold model), P01888 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4L8S_1 Muccosal Associated Invariant T Cell Receptor alpha chain (chains A)
MAGQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKG
RFSSFLSRSKGYSYLLLKELQMKDSASYLCASMDSNYQLIWGAGTKLIIKPNIQNPDPAV
YQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKS
DFACANAFNNSIIPEDTFFPSPESSALE

Sequence of entity 2 (B), FASTA

>4L8S_2 Muccosal Associated Invariant T Cell Receptor beta chain (chains B)
MANAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKG
EVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSETDPNTGELFFGEGSRLTVLEDLK
NVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLK
EQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE
AWGRADSAAALE

Sequence of entity 3 (C), FASTA

>4L8S_3 Beta-2-microglobulin, MHC class I-related protein (chains C)
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWS
FYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDLGGGGSGGSGSGGGGSRTHSLRY
FRLGISEPGYGIPEFISAGYVDSHPITMYNSVSQLXEPRALWMEENLAPDHWERYTQLLR
GWQQAFKVELKQLQHHYNHSGFHTYQRMIGCELLEDGSITGFLQYAYDGQDFLIFNKDTL
SWMAMDNVADIIRRVWEANRHELQYQKNWLEEECIAWLKRFLEYGKDALQRTEPPKVRVN
HKETFPGITTLYCRAYGFYPPEISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVELD
PQNGDIYSCHVEHGGVHMVLQGFQESETILGG

Primary citation

MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1. Lopez-Sagaseta, J., Dulberger, C.L., McFedries, A. et al. J Immunol (2013) 191:5268-5277. DOI 10.4049/jimmunol.1301958 · PubMed

Other PDB entries of the same protein (UniProt Q6P4G7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NW2 1.4 Å, Crystal structure of ELS4 TCR at 1.4A
4L4V 1.9 Å, Structure of human MAIT TCR in complex with human MR1-RL-6-Me-7-OH
4NQE 2.1 Å, Crystal structure of TCR-MR1 ternary complex bound to 5-(2-oxoethylideneamino)-6-D-ribity…
4NQD 2.2 Å, Crystal structure of TCR-MR1 ternary complex and non-covalently bound…
4LCW 2.4 Å, The structure of human MAIT TCR in complex with MR1-K43A-RL-6-Me-7OH
4NQC 2.5 Å, Crystal structure of TCR-MR1 ternary complex and covalently bound…
9C42 2.69 Å, Structure of human MR1-ellagic acid in complex with human MAIT A-F7 TCR
5WKI 2.75 Å, Crystal structure of PG90 TCR-CD1b-PG complex
4IIQ 2.86 Å, Crystal structure of a human MAIT TCR in complex with bovine MR1
4LCC 3.26 Å, Crystal structure of a human MAIT TCR in complex with a bacterial antigen bound to…
4L9L 3.4 Å, Crystal structure of a human Valpha7.2/Vbeta13.2 MAIT TCR in complex with bovine MR1

Browse structure collections

About this viewer

MolViewer shows 4L8S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.