4LCC: Human MAIT TCR

Crystal structure of a human MAIT TCR in complex with a bacterial antigen bound to humanized bovine MR1. Determined by X-ray diffraction at 3.26 Å resolution. Released 16 Oct 2013.

Method: X-ray diffraction
Resolution: 3.26 Å
Organisms: Bos taurus, Homo sapiens
Chains: 3
Atoms: 5,827
Mol. weight: 97.43 kDa
Ligands: 1XL
Released: 16 Oct 2013

Explore 4LCC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LCC contains 16 α-helices and 67 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	8
β-strand	9-13	5	9
β-strand	18-25	8	8
β-strand	30-37	8	9
β-strand	44-49	6	9
β-strand	53-57	5	8
β-strand	60-65	6	8
β-strand	70-75	6	8
α-helix	80-82	3
β-strand	85-91	7	9
β-strand	97-108	12	9
α-helix	109-110	2
β-strand	117-120	4	10
α-helix	121-123	3
β-strand	130-135	6	10
β-strand	152-155	4	10
β-strand	171-176	6	10

Chain B: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	11
β-strand	10-14	5	12
β-strand	19-25	7	11
β-strand	31-37	7	12
β-strand	44-51	8	12
β-strand	54-57	4	12
β-strand	65-68	4	11
β-strand	73-78	6	11
α-helix	83-85	3
β-strand	88-94	7	12
α-helix	102-104	3
β-strand	105-106	2	12
β-strand	110-115	6	12
α-helix	118-120	3
β-strand	122	1	13
β-strand	125-129	5	14
α-helix	130-132	3
α-helix	133-139	7
β-strand	141-151	11	14
β-strand	152	1	13
β-strand	156-162	7	15
β-strand	165-167	3	15
β-strand	171-173	3	14
β-strand	178-179	2	14
β-strand	189-198	10	14
α-helix	199-202	4
β-strand	208-215	8	15
β-strand	218	1	16
β-strand	232	1	16
β-strand	234-241	8	15

Chain C: 7 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	6-11	6	2
β-strand	23-30	8	2
β-strand	31	1	1
β-strand	36-39	4	3
β-strand	46	1	3
β-strand	49-50	2	2
β-strand	54-55	2	2
β-strand	61-66	6	2
β-strand	78-82	5	3
β-strand	91-93	3	3
β-strand	116-125	10	4
β-strand	135-141	7	4
β-strand	144-150	7	4
β-strand	157-158	2	4
α-helix	161-166	6
α-helix	169-197	29
β-strand	204-213	10	4
β-strand	219-227	9	4
β-strand	230-236	7	4
β-strand	241-244	4	4
α-helix	249-257	9
α-helix	261-268	8
α-helix	269-274	6
α-helix	275-289	15
β-strand	293	1	5
β-strand	296-301	6	6
β-strand	310-318	9	6
β-strand	319	1	5
β-strand	324-329	6	7
β-strand	332-333	2	7
α-helix	334	1
β-strand	338-345	8	6
β-strand	351-358	8	6
β-strand	367-372	6	7
β-strand	377-383	7	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-2-microglobulin, MHC class I-related protein	C	protein	392	Bos taurus	C1ITJ8 (AlphaFold model), P01888 (AlphaFold model)
Human MAIT TCR alpha chain	A	protein	208	Homo sapiens	Q6P4G7 (AlphaFold model)
Human MAIT TCR beta chain	B	protein	253	Homo sapiens	P01850 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>4LCC_1 Beta-2-microglobulin, MHC class I-related protein (chains C)
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWS
FYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDLGGGGSGGSGSGGGGSRTHSLRY
FRLGISEPGYGIPEFISAGYVDSHPITMYNSVSQLKEPRALWMEENLAPDHWERYTQLLR
GWQQMFKVELKQLQHHYNHSGFHTYQRMIGCELLEDGSITGFLQYAYDGQDFLIFNKDTL
SWMAMDNVADIIRRVWEANQHELLYQKNWLEEECIAWLKRFLEYGKDALQRTEPPKVRVN
HKETFPGITTLYCRAYGFYPPEISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVELD
PQNGDIYSCHVEHGGVHMVLQGFQESETILGG

Sequence of entity 2 (A), FASTA

>4LCC_2 Human MAIT TCR alpha chain (chains A)
MAGQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKG
RFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPNIQNPDPAV
YQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKS
DFACANAFNNSIIPEDTFFPSPESSALE

Sequence of entity 3 (B), FASTA

>4LCC_3 Human MAIT TCR beta chain (chains B)
MANAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKG
EVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSVWTGEGSGELFFGEGSRLTVLEDL
KNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPL
KEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSA
EAWGRADSAAALE

Ligands and cofactors

ID	Name	Formula	Copies
1XL	1-deoxy-1-[6-(hydroxymethyl)-2,4-dioxo-3,4-dihydropteridin-8(2H)-yl]-D-arabinit…	C12 H16 N4 O7	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1. Lopez-Sagaseta, J., Dulberger, C.L., McFedries, A. et al. J Immunol (2013) 191:5268-5277. DOI 10.4049/jimmunol.1301958 · PubMed

Other PDB entries of the same protein (UniProt C1ITJ8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IIQ 2.86 Å, Crystal structure of a human MAIT TCR in complex with bovine MR1
4L8S 2.9 Å, Crystal structure of a human Valpha7.2/Vbeta13.3 MAIT TCR in complex with bovine MR1
4L9L 3.4 Å, Crystal structure of a human Valpha7.2/Vbeta13.2 MAIT TCR in complex with bovine MR1
7RNO Model of the Ac-6-FP/hpMR1/bB2m/TAPBPR complex from integrated docking, NMR and…

Browse structure collections

About this viewer

MolViewer shows 4LCC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.