4L9L: Human Valpha7.2/Vbeta13.2 MAIT TCR

Crystal structure of a human Valpha7.2/Vbeta13.2 MAIT TCR in complex with bovine MR1. Determined by X-ray diffraction at 3.4 Å resolution. Released 16 Oct 2013.

Method: X-ray diffraction
Resolution: 3.4 Å
Organisms: Bos taurus, Homo sapiens
Chains: 3
Atoms: 6,041
Mol. weight: 96.92 kDa
Released: 16 Oct 2013

Explore 4L9L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4L9L contains 18 α-helices and 74 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	9
β-strand	9-13	5	10
β-strand	18-24	7	9
β-strand	32-37	6	10
β-strand	44-49	6	10
β-strand	53-57	5	9
β-strand	60-65	6	9
β-strand	70-75	6	9
α-helix	80-82	3
β-strand	85-90	6	10
α-helix	99-102	4
β-strand	103-108	6	10
β-strand	117-120	4	11
β-strand	130-135	6	11
β-strand	151-154	4	11
α-helix	157	1
β-strand	158-159	2	12
β-strand	171-176	6	11
β-strand	197	1	11

Chain B: 5 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	13
β-strand	10-11	2	14
β-strand	19-21	3	15
β-strand	22-25	4	13
β-strand	31-37	7	14
β-strand	44-51	8	14
β-strand	54-57	4	14
β-strand	64	1	15
β-strand	67	1	16
β-strand	73	1	13
β-strand	75	1	16
β-strand	76-78	3	15
α-helix	83-85	3
β-strand	88-94	7	14
β-strand	103-105	3	14
β-strand	109-111	3	14
β-strand	131	1	17
α-helix	132-133	2
β-strand	134-138	5	12
α-helix	139-141	3
α-helix	142-148	7
β-strand	150-160	11	12
β-strand	161	1	17
β-strand	165-171	7	18
β-strand	174-176	3	18
β-strand	180-182	3	12
β-strand	187-188	2	12
β-strand	198-207	10	12
α-helix	208-212	5
β-strand	217-224	8	18
β-strand	227	1	19
β-strand	241	1	19
β-strand	243-250	8	18

Chain C: 10 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	4-6	3
β-strand	9-11	3	2
β-strand	23-25	3	2
β-strand	30	1	3
β-strand	31	1	1
β-strand	50	1	2
β-strand	54-55	2	3
β-strand	61-62	2	3
β-strand	65-66	2	2
β-strand	79-81	3	4
α-helix	89	1
β-strand	90-92	3	4
β-strand	116-125	10	5
β-strand	135-141	7	5
β-strand	144-149	6	5
β-strand	158	1	5
α-helix	161-164	4
α-helix	169-196	28
β-strand	204-213	10	5
β-strand	219-227	9	5
β-strand	230-236	7	5
β-strand	241-244	4	5
α-helix	249-256	8
α-helix	260-268	9
α-helix	269-274	6
α-helix	275-284	10
α-helix	286-289	4
β-strand	293	1	6
β-strand	296-301	6	7
β-strand	310-318	9	7
β-strand	319	1	6
β-strand	324-329	6	8
β-strand	332-333	2	8
α-helix	334	1
β-strand	338-339	2	7
β-strand	344-345	2	7
β-strand	351-358	8	7
β-strand	367-372	6	8
β-strand	377-383	7	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-2-microglobulin, MHC class I-related protein	C	protein	392	Bos taurus	C1ITJ8 (AlphaFold model), P01888 (AlphaFold model)
Human MAIT TCR alpha chain	A	protein	208	Homo sapiens	Q6P4G7 (AlphaFold model)
Human MAIT TCR beta chain	B	protein	252	Homo sapiens	P01850 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>4L9L_1 Beta-2-microglobulin, MHC class I-related protein (chains C)
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWS
FYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDLGGGGSGGSGSGGGGSRTHSLRY
FRLGISEPGYGIPEFISAGYVDSHPITMYNSVSQLXEPRALWMEENLAPDHWERYTQLLR
GWQQAFKVELKQLQHHYNHSGFHTYQRMIGCELLEDGSITGFLQYAYDGQDFLIFNKDTL
SWMAMDNVADIIRRVWEANRHELQYQKNWLEEECIAWLKRFLEYGKDALQRTEPPKVRVN
HKETFPGITTLYCRAYGFYPPEISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVELD
PQNGDIYSCHVEHGGVHMVLQGFQESETILGG

Sequence of entity 2 (A), FASTA

>4L9L_2 Human MAIT TCR alpha chain (chains A)
MAGQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKG
RFSSFLSRSKGYSYLLLKELQMKDSASYLCAPLDSNYQLIWGAGTKLIIKPNIQNPDPAV
YQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKS
DFACANAFNNSIIPEDTFFPSPESSALE

Sequence of entity 3 (B), FASTA

>4L9L_3 Human MAIT TCR beta chain (chains B)
MANAGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKG
EVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSYPPDGGNTIYFGEGSWLTVVEDLK
NVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLK
EQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE
AWGRADSAAALE

Primary citation

MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1. Lopez-Sagaseta, J., Dulberger, C.L., McFedries, A. et al. J Immunol (2013) 191:5268-5277. DOI 10.4049/jimmunol.1301958 · PubMed

Other PDB entries of the same protein (UniProt C1ITJ8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IIQ 2.86 Å, Crystal structure of a human MAIT TCR in complex with bovine MR1
4L8S 2.9 Å, Crystal structure of a human Valpha7.2/Vbeta13.3 MAIT TCR in complex with bovine MR1
4LCC 3.26 Å, Crystal structure of a human MAIT TCR in complex with a bacterial antigen bound to…
7RNO Model of the Ac-6-FP/hpMR1/bB2m/TAPBPR complex from integrated docking, NMR and…

Browse structure collections

About this viewer

MolViewer shows 4L9L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.