Structure of beta2 adrenoceptor bound to BI167107 and an engineered nanobody. Determined by X-ray diffraction at 2.79 Å resolution. Released 25 Sept 2013.
Explore 4LDE in 3D Show helices and sheets RCSB PDB PDBe
4LDE contains 27 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 868-876 | 9 | |
| β-strand | 879-880 | 2 | 1 |
| β-strand | 881 | 1 | 2 |
| β-strand | 882-884 | 3 | 1 |
| β-strand | 890-893 | 4 | 1 |
| β-strand | 896-899 | 4 | 1 |
| α-helix | 904-915 | 12 | |
| β-strand | 922 | 1 | 2 |
| α-helix | 925-945 | 21 | |
| α-helix | 949-954 | 6 | |
| α-helix | 958-976 | 19 | |
| α-helix | 980-987 | 8 | |
| α-helix | 991-998 | 8 | |
| α-helix | 1002-1006 | 5 | |
| α-helix | 1008-1020 | 13 | |
| α-helix | 1024-1060 | 37 | |
| α-helix | 1062-1064 | 3 | |
| α-helix | 1067-1081 | 15 | |
| α-helix | 1082-1086 | 5 | |
| α-helix | 1087-1095 | 9 | |
| α-helix | 1102-1136 | 35 | |
| α-helix | 1138-1144 | 7 | |
| α-helix | 1147-1163 | 17 | |
| α-helix | 1166-1170 | 5 | |
| α-helix | 1179-1186 | 8 | |
| α-helix | 1197-1204 | 8 | |
| α-helix | 1205-1209 | 5 | |
| α-helix | 1210-1225 | 16 | |
| α-helix | 1266-1298 | 33 | |
| α-helix | 1305-1316 | 12 | |
| α-helix | 1318-1325 | 8 | |
| α-helix | 1330-1340 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 3 |
| β-strand | 10-13 | 4 | 4 |
| β-strand | 18-25 | 8 | 3 |
| β-strand | 32-39 | 8 | 4 |
| β-strand | 45-52 | 8 | 4 |
| β-strand | 57-59 | 3 | 4 |
| β-strand | 64 | 1 | 3 |
| β-strand | 67-71 | 5 | 3 |
| β-strand | 77-82 | 6 | 3 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-99 | 9 | 4 |
| β-strand | 107-110 | 4 | 4 |
| β-strand | 114-119 | 6 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lysozyme, Beta-2 adrenergic receptor | A | protein | 469 | Enterobacteria phage T4, Homo sapiens | P00720, P07550 (AlphaFold model) |
| Camelid Antibody Fragment | B | protein | 120 | Lama glama |
>4LDE_1 Lysozyme, Beta-2 adrenergic receptor (chains A) DYKDDDDAENLYFQGNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSEL DKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQM GETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYAADEV WVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGA AHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKAR VIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETCCDFFTNQAYAIASSIVSFYVP LVIMVFVYSRVFQEAKRQLQKIDKFALKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQ DNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLK
>4LDE_2 Camelid Antibody Fragment (chains B) QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYA NSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
| ID | Name | Formula | Copies |
|---|---|---|---|
| P0G | 8-[(1R)-2-{[1,1-dimethyl-2-(2-methylphenyl)ethyl]amino}-1-hydroxyethyl]-5-hydro… | C21 H26 N2 O4 | 1 |
| 1WV | (2S)-2,3-dihydroxypropyl (7Z)-tetradec-7-enoate | C17 H32 O4 | 1 |
Water and common crystallization additives (NA) are not listed.
Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody. Ring, A.M., Manglik, A., Kruse, A.C. et al. Nature (2013) 502:575-579. DOI 10.1038/nature12572 · PubMed
Other PDB entries of the same protein (UniProt P00720), best resolution first:
MolViewer shows 4LDE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.