4LG8: PRPF19 WD40 repeats

Crystal structure of PRPF19 WD40 repeats. Determined by X-ray diffraction at 1.89 Å resolution. Released 7 Aug 2013.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,533
Mol. weight: 39.11 kDa
Released: 7 Aug 2013

Explore 4LG8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LG8 contains 4 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	199-200	2
α-helix	201-204	4
β-strand	208-213	6	1
β-strand	224-230	7	2
β-strand	233-241	9	2
β-strand	246-250	5	2
β-strand	255-260	6	2
β-strand	269-272	4	3
β-strand	278-282	5	3
β-strand	288-292	5	3
β-strand	297-302	6	3
β-strand	309-314	6	4
β-strand	320-325	6	4
β-strand	329-334	6	4
β-strand	340-345	6	4
β-strand	353-358	6	5
β-strand	364-369	6	5
β-strand	374-378	5	5
β-strand	383-388	6	5
β-strand	395-400	6	6
β-strand	406-411	6	6
β-strand	415-420	6	6
β-strand	425-431	7	6
β-strand	438-443	6	7
β-strand	449-454	6	7
β-strand	457-461	5	7
β-strand	466-471	6	7
β-strand	478-483	6	1
α-helix	484	1
α-helix	485-487	3
β-strand	490-494	5	1
β-strand	499-503	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-mRNA-processing factor 19	A	protein	354	Homo sapiens	Q9UMS4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LG8_1 Pre-mRNA-processing factor 19 (chains A)
MHHHHHHSSGRENLYFQGTPEIIQKLQDKATVLTTERKERGKTVPEELVKPEELSKYRQV
ASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSV
VFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYW
AFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPG
HSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYL
ALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL

Primary citation

Crystal structure of the WD40 domain of human PRPF19. Zhang, Y., Li, Y., Liang, X. et al. Biochem Biophys Res Commun (2017) 493:1250-1253. DOI 10.1016/j.bbrc.2017.09.145 · PubMed

Other PDB entries of the same protein (UniProt Q9UMS4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9S2E 2.4 Å, Human intron-lariat spliceosome-Aquarius (ILSaqr)
8C6J 2.8 Å, Human spliceosomal PM5 C* complex
6ID1 2.86 Å, Cryo-EM structure of a human intron lariat spliceosome after Prp43 loaded (ILS2 complex)…
6ID0 2.9 Å, Cryo-EM structure of a human intron lariat spliceosome prior to Prp43 loaded (ILS1…
9XTT 2.92 Å, Human minor spliceosome branching-completed C complex (after step-I)
6ICZ 3.0 Å, Cryo-EM structure of a human post-catalytic spliceosome (P complex) at 3.0 angstrom
8I0T 3.0 Å, The cryo-EM structure of human Bact-III complex
8I0V 3.0 Å, The cryo-EM structure of human post-Bact complex
9XU3 3.0 Å, Human minor spliceosome exon-ligation-ready C* complex (prior to step-II)
9S2F 3.14 Å, Human debranched intron spliceosome (DIS)
6QDV 3.3 Å, Human post-catalytic P complex spliceosome
8I0U 3.3 Å, The cryo-EM structure of human Bact-IV complex

Browse structure collections

About this viewer

MolViewer shows 4LG8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.