Crystal structure of a far upstream element (FUSE) binding protein 1 (FUBP1) from Homo sapiens at 1.95 A resolution. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Nov 2013.
Explore 4LIJ in 3D Show helices and sheets RCSB PDB PDBe
4LIJ contains 15 α-helices and 9 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 100-107 | 8 | 1 |
| α-helix | 108-110 | 3 | |
| α-helix | 111-115 | 5 | |
| α-helix | 117-119 | 3 | |
| α-helix | 120-129 | 10 | |
| β-strand | 132-135 | 4 | 1 |
| β-strand | 144-151 | 8 | 1 |
| α-helix | 153-167 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Far upstream element-binding protein 1 | A, B, C | protein | 90 | Homo sapiens | Q96AE4 (AlphaFold model) |
>4LIJ_1 Far upstream element-binding protein 1 (chains A, B, C) GGTQLPPMHQQQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPE RSCMLTGTPESVQSAKRLLDQIVEKGRPAP
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 2 |
Crystal structure of a far upstream element (FUSE) binding protein 1 (FUBP1) from Homo sapiens at 1.95 A resolution. Joint Center for Structural Genomics (JCSG), Partnership for T-Cell Biology (TCELL). To be published.
Other PDB entries of the same protein (UniProt Q96AE4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4LIJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.