Crystal structure of fourth KH domain of FUBP1. Determined by X-ray diffraction at 1.86 Å resolution. Released 25 Mar 2020.
Explore 6Y24 in 3D Show helices and sheets RCSB PDB PDBe
6Y24 contains 6 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 377-384 | 8 | 1 |
| α-helix | 385-387 | 3 | |
| α-helix | 388-392 | 5 | |
| α-helix | 394-396 | 3 | |
| α-helix | 397-406 | 10 | |
| β-strand | 409-412 | 4 | 1 |
| α-helix | 413 | 1 | |
| β-strand | 424-431 | 8 | 1 |
| α-helix | 433-447 | 15 | |
| β-strand | 452-453 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Far upstream element-binding protein 1 | A | protein | 93 | Homo sapiens | Q96AE4 (AlphaFold model) |
>6Y24_1 Far upstream element-binding protein 1 (chains A) SMQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADP NMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLG
Comparative structural analyses and nucleotide-binding characterization of the four KH domains of FUBP1. Ni, X., Knapp, S., Chaikuad, A. Sci Rep (2020) 10:13459-13459. DOI 10.1038/s41598-020-69832-z · PubMed
Other PDB entries of the same protein (UniProt Q96AE4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Y24 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.