4LJQ: Catalytic core of E3 ligase HOIP

Name: PDB 4LJQ: Crystal structure of the catalytic core of E3 ligase HOIP
Published: 2013-10-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of the catalytic core of E3 ligase HOIP. Determined by X-ray diffraction at 2.45 Å resolution. Released 16 Oct 2013.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,913
Mol. weight: 102.14 kDa
Ligands: ZN
Released: 16 Oct 2013

Explore 4LJQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LJQ contains 43 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	860-864	5
β-strand	869-870	2	5
β-strand	877-878	2	5
β-strand	887-889	3	6
β-strand	896-898	3	6
α-helix	903	1
β-strand	904	1	6
β-strand	905-906	2	7
α-helix	918-920	3
β-strand	923-924	2	7
α-helix	931-934	4
α-helix	939-948	10
β-strand	972	1	8
β-strand	985	1	8
α-helix	999-1012	14
α-helix	1017-1020	4
α-helix	1023-1034	12
α-helix	1040-1041	2
α-helix	1046-1060	15
α-helix	1062	1
α-helix	1064	1

Chain B: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	862-865	4
β-strand	870	1	1
β-strand	877	1	1
β-strand	887-889	3	2
β-strand	896-898	3	2
α-helix	903	1
β-strand	904	1	2
β-strand	905-906	2	3
β-strand	923-924	2	3
α-helix	931-934	4
α-helix	939-948	10
β-strand	972-973	2	4
β-strand	984-985	2	4
α-helix	999-1007	9
α-helix	1017-1020	4
α-helix	1023-1034	12
α-helix	1040-1041	2
α-helix	1046-1060	15

Chains C and D: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	860-865	6
β-strand	869-870	2	9
β-strand	877-878	2	9
β-strand	887-889	3	10
β-strand	896-898	3	10
α-helix	903	1
β-strand	904	1	10
β-strand	905-906	2	11
β-strand	923-924	2	11
α-helix	931-934	4
α-helix	939-948	10
β-strand	972	1	12
β-strand	985	1	12
α-helix	999-1012	14
α-helix	1017-1020	4
α-helix	1023-1034	12
α-helix	1040-1041	2
α-helix	1046-1060	15
α-helix	1062	1
α-helix	1064	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RNF31	A, B, C, D	protein	223	Homo sapiens	Q96EP0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4LJQ_1 E3 ubiquitin-protein ligase RNF31 (chains A, B, C, D)
GPGPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKN
KCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGC
RVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETA
TERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	18

Primary citation

Structural basis for ligase-specific conjugation of linear ubiquitin chains by HOIP. Stieglitz, B., Rana, R.R., Koliopoulos, M.G. et al. Nature (2013) 503:422-426. DOI 10.1038/nature12638 · PubMed

Other PDB entries of the same protein (UniProt Q96EP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KC5 1.54 Å, HOIP-HOIPIN1 complex
4LJO 1.56 Å, Structure of an active ligase (HOIP)/ubiquitin transfer complex
7V8F 1.66 Å, Crystal structure of UBE2L3 bound to HOIP RING1 domain.
4P09 1.7 Å, Crystal structure of HOIP PUB domain
9B0B 1.7 Å, Structure of Optineurin bound to HOIP NZF1 domain
9B12 1.81 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
4OWF 2.0 Å, Crystal structure of the NEMO CoZi in complex with HOIP NZF1 domain
4OYK 2.0 Å, Structure of HOIP PUB domain bound to OTULIN PIM
6SC5 2.1 Å, dAb3/HOIP-RBR-Ligand2
6SC8 2.11 Å, dAb3/HOIP-RBR-Ligand4
6KC6 2.12 Å, HOIP-HOIPIN8 complex
4LJP 2.15 Å, Structure of an active ligase (HOIP-H889A)/ubiquitin transfer complex

Browse structure collections

About this viewer

MolViewer shows 4LJQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.