4LL4: TRX and TXNIP complex

The structure of the TRX and TXNIP complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 5 Feb 2014.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,070
Mol. weight: 93.51 kDa
Released: 5 Feb 2014

Explore 4LL4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LL4 contains 14 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	9-14	6	1
β-strand	26-34	9	1
β-strand	39-41	3	2
β-strand	43-57	15	3
β-strand	62-76	15	3
α-helix	88	1
β-strand	89-91	3	2
β-strand	97-104	8	1
α-helix	105-106	2
β-strand	119-130	12	3
α-helix	135-136	2
β-strand	137-143	7	3
β-strand	160-167	8	4
β-strand	177-184	8	4
β-strand	188-190	3	5
α-helix	193	1
β-strand	194-203	10	4
β-strand	209	1	6
β-strand	210-223	14	7
β-strand	226-238	13	7
β-strand	242	1	6
β-strand	246-256	11	4
β-strand	269-281	13	7
β-strand	288-294	7	7
β-strand	295-297	3	5

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	8
α-helix	8-17	10
β-strand	23-28	6	8
α-helix	33-48	16
β-strand	53-58	6	8
α-helix	63-68	6
β-strand	74	1	4
β-strand	76-81	6	8
β-strand	84-90	7	8
α-helix	94-102	9

Chain C: 2 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	9-14	6	9
β-strand	20-22	3	10
β-strand	26-34	9	9
β-strand	39-41	3	11
β-strand	43-58	16	12
β-strand	61-76	16	12
β-strand	89-91	3	11
β-strand	97-104	8	9
α-helix	105-106	2
β-strand	114-116	3	12
β-strand	119-130	12	12
β-strand	137-143	7	12
β-strand	144-146	3	10
β-strand	160-167	8	13
β-strand	177-184	8	13
β-strand	188-190	3	14
β-strand	194-203	10	13
β-strand	209	1	15
β-strand	210-223	14	16
β-strand	226-238	13	16
β-strand	242	1	15
α-helix	243	1
β-strand	246-256	11	13
β-strand	269-281	13	16
β-strand	288-294	7	16
β-strand	295-297	3	14
β-strand	298	1	12

Chain D: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	17
α-helix	8-17	10
β-strand	22-28	7	17
α-helix	33-48	16
β-strand	52-58	7	17
α-helix	63-68	6
β-strand	74	1	13
β-strand	76-81	6	17
β-strand	84-90	7	17
α-helix	94-104	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin-interacting protein	A, C	protein	315	Homo sapiens	Q9H3M7 (AlphaFold model)
Thioredoxin	B, D	protein	105	Homo sapiens	P10599 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4LL4_1 Thioredoxin-interacting protein (chains A, C)
MFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQ
CKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVD
YWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSSMFIPDGRVSVSA
RIDRKGFCEGDEISIHADFENTSSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHI
ISGTCASWRGKSLRVQKIRPSILGSNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGL
SSRTSSMASRTSSEM

Sequence of entity 2 (B, D), FASTA

>4LL4_2 Thioredoxin (chains B, D)
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Primary citation

The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein. Hwang, J., Suh, H.W., Jeon, Y.H. et al. Nat Commun (2014) 5:2958-2958. DOI 10.1038/ncomms3958 · PubMed

Other PDB entries of the same protein (UniProt Q9H3M7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CQ2 1.4 Å, Crystal Structure of tandem WW domains of ITCH in complex with TXNIP peptide
4GEI 1.5 Å, N-terminal domain of VDUP-1
5DZD 1.57 Å, Crystal Structure of WW4 domain of ITCH in complex with TXNIP peptide
4GFX 1.6 Å, Crystal structure of the N-terminal domain of TXNIP
5DWS 1.65 Å, Crystal Structure of ITCH WW3 domain in complex with TXNIP peptide
5DF6 1.78 Å, Crystal structure of PTPN11 tandem SH2 domains in complex with a TXNIP peptide
4ROJ 1.95 Å, Crystal Structure of the VAV2 SH2 domain in complex with TXNIP phosphorylated peptide
4LL1 2.0 Å, The structure of the TRX and TXNIP complex
4ROF 2.03 Å, Crystal Structure of WW3 domain of ITCH in complex with TXNIP peptide
4GEJ 2.9 Å, N-terminal domain of VDUP-1

Browse structure collections

About this viewer

MolViewer shows 4LL4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.