4LXD: Apoptosis regulator Bcl-2

Bcl_2-Navitoclax Analog (without Thiophenyl) Complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 Aug 2013.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,469
Mol. weight: 20.08 kDa
Ligands: 1XV
Released: 14 Aug 2013

Explore 4LXD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LXD contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	9-23	15
α-helix	90-104	15
α-helix	106-115	10
α-helix	123-134	12
α-helix	141-160	20
α-helix	166-177	12
α-helix	178-182	5
α-helix	183-188	6
α-helix	191-199	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator Bcl-2	A	protein	166	Homo sapiens	P10415 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LXD_1 Apoptosis regulator Bcl-2 (chains A)
MAHPGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLTLRQAG
DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVES
VNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMR

Ligands and cofactors

ID	Name	Formula	Copies
1XV	4-(4-{[4-(4-chlorophenyl)-5,6-dihydro-2H-pyran-3-yl]methyl}piperazin-1-yl)-N-{[…	C34 H38 Cl N5 O7 S	1

Primary citation

ABT-199, a potent and selective BCL-2 inhibitor, achieves antitumor activity while sparing platelets. Souers, A.J., Leverson, J.D., Boghaert, E.R. et al. Nat Med (2013) 19:202-208. DOI 10.1038/nm.3048 · PubMed

Other PDB entries of the same protein (UniProt P10415 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HTS 1.25 Å, Crystal structure of Bcl2 in complex with S-10r
6GL8 1.4 Å, Crystal structure of Bcl-2 in complex with the novel orally active inhibitor S55746
6QGG 1.5 Å, Structure of human Bcl-2 in complex with analogue of ABT-737
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
8HTR 1.6 Å, Crystal structure of Bcl2 in complex with S-9c
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2
9O16 1.73 Å, Crystal Structure of human BCL-2 (R129L) mutant in complex with a stapled BAD BH3…
6O0M 1.75 Å, crystal structure of BCL-2 F104L mutation with venetoclax
5VAU 1.75 Å, Bcl-2 complex with Beclin 1 BH3 domain
8VWX 1.77 Å, Human Bcl-2 (G101V Mutant)/Bcl-xL Chimera Fused to Maltose-Binding Protein

Browse structure collections

About this viewer

MolViewer shows 4LXD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.