4LXS: Protein toll

Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and innate immunity (glycosylated form). Determined by X-ray diffraction at 3.3 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Drosophila melanogaster
Chains: 3
Atoms: 7,311
Mol. weight: 120.61 kDa
Ligands: NAG
Released: 9 Apr 2014

Explore 4LXS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LXS contains 28 α-helices and 67 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 52 β-strands

Element	Residues	Length	Sheet
α-helix	31-35	5
β-strand	44	1	1
β-strand	47-48	2	2
β-strand	51-53	3	2
β-strand	55	1	1
β-strand	56	1	2
β-strand	65-70	6	2
β-strand	74-79	6	2
α-helix	84-89	6
α-helix	91	1
β-strand	97-98	2	3
β-strand	101-105	5	2
α-helix	107-109	3
α-helix	115-121	7
β-strand	124-125	2	3
β-strand	129-133	5	2
α-helix	143-146	4
β-strand	154-158	5	2
β-strand	178-182	5	2
α-helix	190-192	3
β-strand	201-203	3	2
α-helix	212-213	2
β-strand	225-227	3	2
α-helix	238-241	4
β-strand	249-251	3	2
β-strand	273-275	3	2
β-strand	297-300	4	2
β-strand	309	1	4
α-helix	310-311	2
β-strand	323-326	4	2
β-strand	332	1	4
α-helix	335-338	4
β-strand	346	1	5
β-strand	347-348	2	2
β-strand	356	1	6
α-helix	359-362	4
β-strand	370-372	3	5
β-strand	380	1	6
β-strand	394-396	3	5
β-strand	418-420	3	5
α-helix	432-434	3
β-strand	442-444	3	5
α-helix	456-460	5
β-strand	477-479	3	5
α-helix	491-494	4
β-strand	501-503	3	5
β-strand	511-513	3	7
β-strand	525-528	4	5
β-strand	536-538	3	7
β-strand	554-557	4	5
β-strand	564	1	8
α-helix	567-569	3
α-helix	570-576	7
α-helix	584-587	4
β-strand	588-591	4	5
β-strand	596	1	9
β-strand	599	1	8
β-strand	607	1	9
β-strand	617-618	2	10
α-helix	631-632	2
β-strand	636-640	5	10
β-strand	645-649	5	10
α-helix	658-665	8
β-strand	670-674	5	10
α-helix	691-693	3
β-strand	696-698	3	10
β-strand	718-720	3	10
α-helix	731-736	6
β-strand	745-747	3	10
β-strand	753	1	11
α-helix	760-768	9
β-strand	773	1	10
α-helix	776-778	3
β-strand	780	1	12
β-strand	781	1	11
β-strand	789	1	12
α-helix	790-792	3

Chain J: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	13
β-strand	12	1	14
β-strand	15-16	2	15
β-strand	43-44	2	15
β-strand	47	1	14
β-strand	53	1	16
α-helix	54	1
β-strand	65-73	9	16
β-strand	95-104	10	16

Chain K: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	16
β-strand	12-15	4	17
β-strand	44-47	4	17
α-helix	52	1
β-strand	53	1	18
α-helix	54	1
β-strand	67-72	6	18
β-strand	96-102	7	18
β-strand	103	1	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein toll	A	protein	783	Drosophila melanogaster	P08953 (AlphaFold model)
Protein spaetzle C-106	J, K	protein	114	Drosophila melanogaster	P48607 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LXS_1 Protein toll (chains A)
SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDY
QQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLD
RLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSN
KLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAH
LTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLR
AELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFA
HTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDH
NDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYN
NISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDC
TILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPR
ERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSAN
TPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVK
LSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMCVNAEMPTRMVELSTNDICPAETGHHH
HHH

Sequence of entity 2 (J, K), FASTA

>4LXS_2 Protein spaetzle C-106 (chains J, K)
VGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAANF
PQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTGLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Water and common crystallization additives (EPE) are not listed.

Primary citation

Structure of the Toll-Spatzle complex, a molecular hub in Drosophila development and innate immunity. Parthier, C., Stelter, M., Ursel, C. et al. Proc Natl Acad Sci U S A (2014) 111:6281-6286. DOI 10.1073/pnas.1320678111 · PubMed

Other PDB entries of the same protein (UniProt P08953 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LXR 2.2 Å, Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and…
4BV4 2.35 Å, Structure and allostery in Toll-Spatzle recognition
4ARN 2.41 Å, Crystal structure of the N-terminal domain of Drosophila Toll receptor
4ARR 3.0 Å, Crystal structure of the N-terminal domain of Drosophila Toll receptor with the magic…

Browse structure collections

About this viewer

MolViewer shows 4LXS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.