4MHL: Human interleukin-11

The crystal structure of human interleukin-11. Determined by X-ray diffraction at 2.09 Å resolution. Released 3 Sept 2014.

Method: X-ray diffraction
Resolution: 2.09 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,309
Mol. weight: 19.39 kDa
Ligands: ARF
Released: 3 Sept 2014

Explore 4MHL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MHL contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	35-63	29
α-helix	76-79	4
α-helix	90-114	25
α-helix	117-122	6
α-helix	123-146	24
α-helix	163-164	2
α-helix	167-197	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-11	A	protein	177	Homo sapiens	P20809 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MHL_1 Interleukin-11 (chains A)
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSA
GALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQL
LMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Ligands and cofactors

ID	Name	Formula	Copies
ARF	Formamide	C H3 N O	5

Water and common crystallization additives (SO4) are not listed.

Primary citation

The structure of human interleukin-11 reveals receptor-binding site features and structural differences from interleukin-6. Putoczki, T.L., Dobson, R.C., Griffin, M.D. Acta Crystallogr D Biol Crystallogr (2014) 70:2277-2285. DOI 10.1107/S1399004714012267 · PubMed

Other PDB entries of the same protein (UniProt P20809 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8DPV 1.48 Å, The crystal structure of Interleukin-11, W147A mutant
6O4O 1.62 Å, The structure of human interleukin 11
8DPW 1.8 Å, The structure of Interleukin-11 Mutein
8QY4 3.06 Å, Structure of interleukin 11 (gp130 P496L mutant).
8DPS 3.47 Å, The structure of the interleukin 11 signalling complex, truncated gp130
8DPU 3.78 Å, The crystal structure of the IL-11 signalling complex
8DPT 4.0 Å, The structure of the IL-11 signalling complex, with full-length extracellular gp130

Browse structure collections

About this viewer

MolViewer shows 4MHL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.