6O4O: Human interleukin 11

The structure of human interleukin 11. Determined by X-ray diffraction at 1.62 Å resolution. Released 6 May 2020.

Method: X-ray diffraction
Resolution: 1.62 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,470
Mol. weight: 18.4 kDa
Released: 6 May 2020

Explore 6O4O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6O4O contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	14-42	29
α-helix	55-57	3
α-helix	66-68	3
α-helix	69-93	25
α-helix	96-101	6
α-helix	104-125	22
α-helix	128-132	5
α-helix	134-143	10
α-helix	146-175	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-11	A	protein	169	Homo sapiens	P20809 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6O4O_1 Interleukin-11 (chains A)
GSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQL
PGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALP
QPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Primary citation

The structure of the extracellular domains of human interleukin 11 alpha receptor reveals mechanisms of cytokine engagement. Metcalfe, R.D., Aizel, K., Zlatic, C.O. et al. J Biol Chem (2020) 295:8285-8301. DOI 10.1074/jbc.RA119.012351 · PubMed

Other PDB entries of the same protein (UniProt P20809 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8DPV 1.48 Å, The crystal structure of Interleukin-11, W147A mutant
8DPW 1.8 Å, The structure of Interleukin-11 Mutein
4MHL 2.09 Å, The crystal structure of human interleukin-11
8QY4 3.06 Å, Structure of interleukin 11 (gp130 P496L mutant).
8DPS 3.47 Å, The structure of the interleukin 11 signalling complex, truncated gp130
8DPU 3.78 Å, The crystal structure of the IL-11 signalling complex
8DPT 4.0 Å, The structure of the IL-11 signalling complex, with full-length extracellular gp130

Browse structure collections

About this viewer

MolViewer shows 6O4O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.