4MQS: Muscarinic acetylcholine receptor M2

Structure of active human M2 muscarinic acetylcholine receptor bound to the agonist iperoxo. Determined by X-ray diffraction at 3.5 Å resolution. Released 27 Nov 2013.

Method: X-ray diffraction
Resolution: 3.5 Å
Organisms: Homo sapiens, Lama glama
Chains: 2
Atoms: 3,034
Mol. weight: 53.58 kDa
Ligands: IXO
Released: 27 Nov 2013

Explore 4MQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MQS contains 20 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	22-50	29
α-helix	57-71	15
α-helix	72-76	5
α-helix	77-86	10
α-helix	93-126	34
α-helix	131-134	4
α-helix	137-160	24
α-helix	162-166	5
α-helix	184-191	8
α-helix	192-196	5
α-helix	197-213	17
α-helix	381-410	30
α-helix	414-416	3
α-helix	419-430	12
α-helix	432-436	5
α-helix	437-441	5
α-helix	445-452	8

Chain B: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	11-12	2	2
β-strand	18-25	8	1
α-helix	32-34	3
β-strand	36-42	7	3
β-strand	49-55	7	3
β-strand	60-63	4	3
β-strand	71-76	6	1
β-strand	81-86	6	1
α-helix	91-93	3
β-strand	95-102	8	3
α-helix	104-106	3
β-strand	109-111	3	3
β-strand	115-117	3	3
β-strand	118-119	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic acetylcholine receptor M2	A	protein	351	Homo sapiens	P08172 (AlphaFold model)
Nanobody 9-8	B	protein	125	Lama glama

Sequence of entity 1 (A), FASTA

>4MQS_1 Muscarinic acetylcholine receptor M2 (chains A)
DYKDDDENLYFQGLEMDDSTDSSDNSLALTSPYLEKTFEVVFIVLVAGSLSLVTIIGNIL
VMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALD
YVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQ
FIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKE
PVANQDPVSTRKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWT
IGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATRHHHHHHHH

Sequence of entity 2 (B), FASTA

>4MQS_2 Nanobody 9-8 (chains B)
GPGSQVQLQESGGGLVQAGDSLRLSCAASGFDFDNFDDYAIGWFRQAPGQEREGVSCIDP
SDGSTIYADSAKGRFTISSDNAENTVYLQMNSLKPEDTAVYVCSAWTLFHSDEYWGQGTQ
VTVSS

Ligands and cofactors

ID	Name	Formula	Copies
IXO	4-(4,5-dihydro-1,2-oxazol-3-yloxy)-N,N,N-trimethylbut-2-yn-1-aminium	C10 H17 N2 O2	1

Primary citation

Activation and allosteric modulation of a muscarinic acetylcholine receptor. Kruse, A.C., Ring, A.M., Manglik, A. et al. Nature (2013) 504:101-106. DOI 10.1038/nature12735 · PubMed

Other PDB entries of the same protein (UniProt P08172 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZKC 2.3 Å, Crystal structure of rationally thermostabilized M2 muscarinic acetylcholine receptor…
5YC8 2.5 Å, Crystal structure of rationally thermostabilized M2 muscarinic acetylcholine receptor…
5ZK3 2.6 Å, Crystal structure of rationally thermostabilized M2 muscarinic acetylcholine receptor…
8J8R 2.9 Å, Structure of beta-arrestin2 in complex with M2Rpp
5ZKB 2.95 Å, Crystal structure of rationally thermostabilized M2 muscarinic acetylcholine receptor…
3UON 3.0 Å, Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist
5ZK8 3.0 Å, Crystal structure of M2 muscarinic acetylcholine receptor bound with NMS
8JAF 3.1 Å, Structure of Muscarinic receptor (M2R) in complex with beta-arrestin1 (Local Refine,…
7T94 3.16 Å, Cryo-EM structure of S1 state ACh-bound M2R-Go signaling complex with a PAM
8J97 3.2 Å, Structure of Muscarinic receptor (M2R) in complex with beta-arrestin1 (Local refine,…
7T8X 3.21 Å, Cryo-EM structure of ACh-bound M2R-Go signaling complex in S1 state
7T96 3.22 Å, Cryo-EM structure of S2 state ACh-bound M2R-Go signaling complex with a PAM

Browse more

4MQS is part of these collections:

GPCRs and cell signaling

About this viewer

MolViewer shows 4MQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.