4MX3: PKA RIalpha Homodimer

Crystal Structure of PKA RIalpha Homodimer. Determined by X-ray diffraction at 3.88 Å resolution. Released 15 Jan 2014.

Method: X-ray diffraction
Resolution: 3.88 Å
Organism: Bos taurus
Chains: 2
Atoms: 4,217
Mol. weight: 86.95 kDa
Ligands: CMP
Released: 15 Jan 2014

Explore 4MX3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MX3 contains 21 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	118	1	1
α-helix	120-132	13
α-helix	134-138	5
α-helix	141-150	10
β-strand	152	1	2
β-strand	155-156	2	2
β-strand	161	1	3
β-strand	171-177	7	2
β-strand	179-182	4	3
β-strand	191-193	3	3
β-strand	198	1	2
α-helix	200-204	5
β-strand	213-215	3	3
β-strand	219-225	7	2
α-helix	226-242	17
α-helix	245-249	5
α-helix	259-266	8
β-strand	270	1	4
β-strand	273-274	2	5
β-strand	279	1	5
β-strand	289	1	6
β-strand	291-299	9	5
β-strand	315-316	2	5
β-strand	321-322	2	5
α-helix	324-329	6
β-strand	338-346	9	5
β-strand	347	1	4
β-strand	349	1	6
α-helix	350-356	7
α-helix	358-360	3
α-helix	363-366	4

Chain B: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	118	1	1
α-helix	120-132	13
α-helix	134-138	5
α-helix	142-150	9
β-strand	152	1	7
β-strand	155-156	2	7
β-strand	161	1	8
β-strand	171-177	7	7
β-strand	179-183	5	8
β-strand	191-193	3	8
β-strand	197-198	2	7
α-helix	201-204	4
β-strand	212-214	3	8
β-strand	219-225	7	7
α-helix	226-242	17
α-helix	245-249	5
α-helix	259-266	8
β-strand	270	1	9
β-strand	291-296	6	9
β-strand	298	1	10
β-strand	316	1	10
β-strand	321-322	2	9
α-helix	324-329	6
β-strand	343-347	5	9
α-helix	350-356	7
α-helix	362-368	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type I-alpha regulatory subunit	A, B	protein	379	Bos taurus	P00514 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4MX3_1 cAMP-dependent protein kinase type I-alpha regulatory subunit (chains A, B)
ASGTTASEEERSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEA
KQIQNLQKAGSRADSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDY
KTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEM
DVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRK
RKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAV
LQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPC
SDILKRNIQQYNSFVSLSV

Ligands and cofactors

ID	Name	Formula	Copies
CMP	Adenosine-3',5'-cyclic-monophosphate	C10 H12 N5 O6 P	4

Primary citation

PKA RI alpha Homodimer Structure Reveals an Intermolecular Interface with Implications for Cooperative cAMP Binding and Carney Complex Disease. Bruystens, J.G., Wu, J., Fortezzo, A. et al. Structure (2014) 22:59-69. DOI 10.1016/j.str.2013.10.012 · PubMed

Other PDB entries of the same protein (UniProt P00514 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PNA 1.5 Å, Crystal Structure of cAMP bound (91-244)RIa Subunit of cAMP-dependent Protein Kinase
3FHI 2.0 Å, Crystal structure of a complex between the catalytic and regulatory (RI{alpha}) subunits…
3IM3 2.0 Å, Crystal structure of PKA RI alpha dimerization/docking domain
5HVZ 2.0 Å, Crystal structure of smAKAP AKB domain bound RIa dimerization/docking (D/D) complex at…
2QCS 2.2 Å, A complex structure between the Catalytic and Regulatory subunit of Protein Kinase A…
3IM4 2.29 Å, Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in…
1NE6 2.3 Å, Crystal structure of Sp-cAMP binding R1a subunit of cAMP-dependent protein kinase
3PLQ 2.3 Å, Crystal structure of PKA type I regulatory subunit bound with Rp-8-Br-cAMPS
1NE4 2.4 Å, Crystal Structure of Rp-cAMP Binding R1a Subunit of cAMP-dependent Protein Kinase
4X6R 2.4 Å, An Isoform-specific Myristylation Switch Targets RIIb PKA Holoenzymes to Membranes
1RL3 2.7 Å, Crystal structure of cAMP-free R1a subunit of PKA
3IIA 2.7 Å, Crystal structure of apo (91-244) RIa subunit of cAMP-dependent protein kinase

Browse structure collections

About this viewer

MolViewer shows 4MX3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.