4N0N: Arterivirus nonstructural protein 10

Crystal structure of Arterivirus nonstructural protein 10 (helicase). Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Jan 2014.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Equine arteritis virus
Chains: 1
Atoms: 3,266
Mol. weight: 46.36 kDa
Ligands: MG, ZN
Released: 8 Jan 2014

Explore 4N0N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N0N contains 20 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	13-15	3	1
β-strand	20-21	2	1
α-helix	26-29	4
β-strand	35-37	3	1
β-strand	45	1	1
α-helix	46-48	3
β-strand	49	1	2
β-strand	53	1	2
α-helix	65-66	2
α-helix	70-81	12
β-strand	87-91	5	3
β-strand	92	1	4
β-strand	95-96	2	4
α-helix	99	1
β-strand	101-105	5	4
β-strand	108-113	6	4
β-strand	119-122	4	4
β-strand	127-131	5	3
β-strand	132-133	2	4
α-helix	134-136	3
α-helix	143-151	9
β-strand	154-157	4	5
α-helix	164-174	11
β-strand	179-182	4	5
α-helix	186-198	13
β-strand	204-205	2	5
α-helix	215-218	4
β-strand	223-226	4	5
β-strand	236-239	4	5
α-helix	247-256	10
β-strand	260-263	4	5
α-helix	282-284	3
β-strand	286-287	2	5
α-helix	289-291	3
β-strand	293	1	6
α-helix	299-304	6
α-helix	312	1
β-strand	313	1	6
α-helix	314-315	2
β-strand	320-323	4	7
β-strand	333-336	4	7
α-helix	339-341	3
β-strand	347-348	2	7
α-helix	350-352	3
β-strand	357-363	7	7
α-helix	372-378	7
β-strand	382-389	8	7
α-helix	395-398	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replicase polyprotein 1ab	A	protein	423	Equine arteritis virus	P19811 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4N0N_1 Replicase polyprotein 1ab (chains A)
MGSSHHHHHSSGENLYFQGHMSAVCTVCGAAPVAKSACGGWFCGNCVPYHAGHCHTTSLF
ANCGHDIMYRSTYCTMCEGSPKQMVPKVPHPILDHLLCHIDYGSKEELTLVVADGRTTSP
PGRYKVGHKVVAVVADVGGNIVFGCGPGSHIAVPLQDTLKGVVVNKALKNAAASEYVEGP
PGSGKTFHLVKDVLAVVGSATLVVPTHASMLDCINKLKQAGADPYFVVPKYTVLDFPRPG
SGNITVRLPQVGTSEGETFVDEVAYFSPVDLARILTQGRVKGYGDLNQLGCVGPASVPRN
LWLRHFVSLEPLRVCHRFGAAVCDLIKGIYPYYEPAPHTTKVVFVPNPDFEKGVVITAYH
KDRGLGHRTIDSIQGCTFPVVTLRLPTPQSLTRPRAVVAVTRASQELYIYDPFDQLSGLL
KFT

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	3

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structural basis for the regulatory function of a complex zinc-binding domain in a replicative arterivirus helicase resembling a nonsense-mediated mRNA decay helicase. Deng, Z., Lehmann, K.C., Li, X. et al. Nucleic Acids Res (2014) 42:3464-3477. DOI 10.1093/nar/gkt1310 · PubMed

Other PDB entries of the same protein (UniProt P19811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IUM 1.45 Å, Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
1MBM 2.0 Å, NSP4 proteinase from Equine Arteritis Virus
4N0O 2.65 Å, Complex structure of Arterivirus nonstructural protein 10 (helicase) with DNA
5HBZ 3.1 Å, Structure of EAV NSP11 K170A mutant at 3.10A
5HC1 3.1 Å, Structure of EAV NSP11 H141A mutant at 3.10A
5F17 3.2 Å, Structure of EAV NSP11 K170A mutant at 3.19A
2L8K NMR Structure of the Arterivirus nonstructural protein 7 alpha (nsp7 alpha)

Browse structure collections

About this viewer

MolViewer shows 4N0N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.