4N0Y: IGH526 Heavy Chain

Structure of the Hepatitis C Envelope Glycoprotein E1 antigenic region 314-324 bound to the cross-neutralizing antibody IGH526. Determined by X-ray diffraction at 1.75 Å resolution. Released 1 Apr 2015.

Method: X-ray diffraction
Resolution: 1.75 Å
Organisms: Homo sapiens, Hepatitis C virus
Chains: 3
Atoms: 3,762
Mol. weight: 49.46 kDa
Released: 1 Apr 2015

Explore 4N0Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N0Y contains 20 α-helices and 49 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	316-323	8

Chain H: 10 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-6A	4	1
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	57-59	3	2
β-strand	67-72	6	1
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-95	8	2
β-strand	98	1	3
β-strand	100E	1	3
β-strand	100H-103	4	2
β-strand	107-111	5	2
α-helix	114-116	3
β-strand	117	1	4
α-helix	118-119	2
β-strand	120-127	8	5
β-strand	135-145	11	5
β-strand	146	1	4
β-strand	151-154	4	6
α-helix	155-157	3
β-strand	159	1	6
β-strand	163-165	3	5
α-helix	166-168	3
β-strand	169-170	2	5
α-helix	171	1
β-strand	176-185	10	5
α-helix	186-188	3
β-strand	195-200	6	6
α-helix	201-203	3
β-strand	205-210	6	6

Chain L: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	7
β-strand	5	1	8
β-strand	9-13	4	9
β-strand	19-24	6	8
α-helix	27-29	5
β-strand	33-38	6	9
β-strand	45-48	4	9
β-strand	49	1	10
β-strand	53	1	10
α-helix	54-55	2
β-strand	62-67	6	8
β-strand	70-75	6	8
α-helix	80-82	3
β-strand	84-92	9	9
β-strand	95B-98	4	9
β-strand	99	1	7
β-strand	102-106	5	9
α-helix	108-110	3
β-strand	111	1	11
α-helix	112-113	2
β-strand	114-118	5	12
α-helix	119-121	3
α-helix	122-126	5
β-strand	130-139	10	12
β-strand	140	1	11
β-strand	145-150	6	13
β-strand	153-155	3	13
β-strand	159-161	3	12
α-helix	162-164	3
β-strand	165-166	2	12
β-strand	172-180	9	12
α-helix	182-187	6
β-strand	191-197	7	13
β-strand	200-206	7	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGH526 Heavy Chain	H	protein	231	Homo sapiens
IGH526 Light Chain	L	protein	218	Homo sapiens
HCV E1 peptide	A	protein	12	Hepatitis C virus	P27958 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>4N0Y_1 IGH526 Heavy Chain (chains H)
EVQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAK
YSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGT
LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGS

Sequence of entity 2 (L), FASTA

>4N0Y_2 IGH526 Light Chain (chains L)
EIELTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHNNDLRPSG
VPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVFGGGTKLTVLGQPKAAPS
VTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAA
SSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 3 (A), FASTA

>4N0Y_3 HCV E1 peptide (chains A)
TGHRMAWDMMMX

Primary citation

Structure of Hepatitis C Virus Envelope Glycoprotein E1 Antigenic Site 314-324 in Complex with Antibody IGH526. Kong, L., Kadam, R.U., Giang, E. et al. J Mol Biol (2015) 427:2617-2628. DOI 10.1016/j.jmb.2015.06.012 · PubMed

Other PDB entries of the same protein (UniProt P27958 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BZY 1.6 Å, Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423…
5FGB 1.65 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQJ 1.69 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
2XI3 1.7 Å, HCV-H77 NS5B Polymerase Complexed With GTP
2XI2 1.8 Å, HCV-H77 NS5B Apo Polymerase
6UYD 1.9 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2mc3-v1 redesigned core from…
5FGC 1.9 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQK 1.97 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
5EOC 1.98 Å, Crystal structure of Fab C2 in complex with a Cyclic variant of Hepatitis C Virus E2…
2O8M 2.0 Å, Crystal structure of the S139A mutant of Hepatitis C Virus NS3/4A protease
4XVJ 2.0 Å, Structure of the hepatitis C virus envelope glycoprotein E2 antigenic 2 region 412-423…
4Z0X 2.0 Å, Structure of Hepatitis C Virus Envelope glycoprotein E2 antigenic region 434-446 bound…

Browse structure collections

About this viewer

MolViewer shows 4N0Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.