4NF9: Knl1/Nsl1 complex

Structure of the Knl1/Nsl1 complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 Mar 2014.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,716
Mol. weight: 58.61 kDa
Released: 19 Mar 2014

Explore 4NF9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NF9 contains 24 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2097-2104	8
β-strand	2109-2114	6	1
β-strand	2118-2123	6	1
β-strand	2128-2134	7	1
α-helix	2135-2136	2
α-helix	2141-2143	3
α-helix	2146-2148	3
β-strand	2150	1	2
β-strand	2151-2158	8	1
β-strand	2160	1	3
α-helix	2167-2182	16
α-helix	2184-2186	3
β-strand	2192	1	2
α-helix	2193-2195	3
α-helix	2196-2223	28
α-helix	2224-2227	4
β-strand	2229-2235	7	4
β-strand	2238-2245	8	4
β-strand	2250-2257	8	4
α-helix	2266-2268	3
β-strand	2269-2275	7	4
α-helix	2280-2287	8
α-helix	2296-2307	12

Chain B: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2110-2114	5	5
β-strand	2118-2123	6	5
β-strand	2128-2134	7	5
α-helix	2135-2136	2
α-helix	2140	1
α-helix	2146-2148	3
β-strand	2150	1	6
β-strand	2151-2158	8	5
β-strand	2160	1	7
α-helix	2167-2183	17
α-helix	2184-2186	3
β-strand	2192	1	6
α-helix	2196-2223	28
α-helix	2224-2227	4
β-strand	2229-2235	7	8
β-strand	2238-2245	8	8
β-strand	2250-2257	8	8
α-helix	2266-2268	3
β-strand	2269-2275	7	8
α-helix	2280-2287	8
α-helix	2296-2308	13

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	272	1	3

Chain D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	271	1
β-strand	272	1	7
α-helix	273	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein CASC5	A, B	protein	221	Homo sapiens	Q8NG31 (AlphaFold model)
Kinetochore-associated protein NSL1 homolog	C, D	protein	26	Homo sapiens	Q96IY1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4NF9_1 Protein CASC5 (chains A, B)
QKQRNRTEELLDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRK
IVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKMLEEFSLVVHHC
RLLGEEIEYLKRWGPNYNLMNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPST
IQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQD

Sequence of entity 2 (C, D), FASTA

>4NF9_2 Kinetochore-associated protein NSL1 homolog (chains C, D)
LKRKQTKDCPQRKWYPLRPKKINLDT

Primary citation

Modular Assembly of RWD Domains on the Mis12 Complex Underlies Outer Kinetochore Organization. Petrovic, A., Mosalaganti, S., Keller, J. et al. Mol Cell (2014) 53:591-605. DOI 10.1016/j.molcel.2014.01.019 · PubMed

Other PDB entries of the same protein (UniProt Q8NG31 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SI5 2.2 Å, Kinetochore-BUBR1 kinase complex
4NFA 2.5 Å, Structure of the C-terminal doamin of Knl1
4A1G 2.6 Å, The crystal structure of the human Bub1 TPR domain in complex with the KI motif of Knl1
6CZO 2.95 Å, The KNL1-PP1 Holoenzyme
8PPR 3.0 Å, Structure of the human outer kinetochore KMN network complex
8Q5H 4.5 Å, Human KMN network (outer kinetochore)

Browse structure collections

About this viewer

MolViewer shows 4NF9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.