Structure of human Dicer Platform-PAZ-Connector Helix cassette in complex with 16-mer siRNA having 5'-p and UU-3' ends (3.4 Angstrom resolution). Determined by X-ray diffraction at 3.4 Å resolution. Released 5 Mar 2014.
Explore 4NHA in 3D Show helices and sheets RCSB PDB PDBe
4NHA contains 13 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 761-770 | 10 | 1 |
| α-helix | 771-772 | 2 | |
| α-helix | 785-787 | 3 | |
| β-strand | 791-794 | 4 | 1 |
| β-strand | 808-810 | 3 | 1 |
| β-strand | 813-821 | 9 | 1 |
| α-helix | 830-841 | 12 | |
| α-helix | 842-847 | 6 | |
| β-strand | 868-871 | 4 | 1 |
| β-strand | 872 | 1 | 2 |
| β-strand | 880 | 1 | 2 |
| α-helix | 884-890 | 7 | |
| α-helix | 915-917 | 3 | |
| β-strand | 921-924 | 4 | 3 |
| α-helix | 925-927 | 3 | |
| β-strand | 935-941 | 7 | 3 |
| β-strand | 949 | 1 | 4 |
| α-helix | 950 | 1 | |
| β-strand | 957 | 1 | 4 |
| α-helix | 958-966 | 9 | |
| α-helix | 975-976 | 2 | |
| β-strand | 977-982 | 6 | 3 |
| β-strand | 1022-1023 | 2 | 3 |
| α-helix | 1025-1027 | 3 | |
| β-strand | 1028-1031 | 4 | 3 |
| α-helix | 1035-1041 | 7 | |
| α-helix | 1044-1052 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endoribonuclease Dicer | A | protein | 302 | Homo sapiens | Q9UPY3 (AlphaFold model) |
| 5'-r(p*gp*cp*gp*up*up*gp*gp*cp*cp*ap*ap*cp*gp*cp*up*u)-3' | B | RNA | 16 |
>4NHA_1 Endoribonuclease Dicer (chains A) SDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSG EVTISIELKKSGFMLSLQMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNV VNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPH RFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPR HLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHC LL
>4NHA_2 5'-R(P*GP*CP*GP*UP*UP*GP*GP*CP*CP*AP*AP*CP*GP*CP*UP*U)-3' (chains B) GCGUUGGCCAACGCUU
A Phosphate-Binding Pocket within the Platform-PAZ-Connector Helix Cassette of Human Dicer. Tian, Y., Simanshu, D.K., Ma, J.B. et al. Mol Cell (2014) 53:606-616. DOI 10.1016/j.molcel.2014.01.003 · PubMed
Other PDB entries of the same protein (UniProt Q9UPY3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4NHA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.