4NS5: Human BS69 Bromo-Zinc finger-PWWP

Crystal structure of human BS69 Bromo-Zinc finger-PWWP. Determined by X-ray diffraction at 1.9 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,653
Mol. weight: 27.36 kDa
Ligands: ZN
Released: 9 Apr 2014

Explore 4NS5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NS5 contains 10 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	157-169	13
α-helix	198-206	9
α-helix	213-231	19
α-helix	236-257	22
α-helix	259-267	9
α-helix	272-274	3
α-helix	280-282	3
β-strand	283-287	5	1
β-strand	293-302	10	1
β-strand	305-310	6	1
β-strand	317-321	5	1
α-helix	322-324	3
β-strand	325-327	3	1
α-helix	332-334	3
α-helix	341-359	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Zinc finger MYND domain-containing protein 11	A	protein	227	Homo sapiens	Q15326 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4NS5_1 Zinc finger MYND domain-containing protein 11 (chains A)
MNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRS
YEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNW
FCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNI
HRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding. Wang, J., Qin, S., Li, F. et al. Cell Res (2014) 24:890-893. DOI 10.1038/cr.2014.38 · PubMed

Other PDB entries of the same protein (UniProt Q15326 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XU6 1.63 Å, Structural Insights into the Tumor Suppressor ZMYND11 Reveal Diverse Recognition…
9LOM 1.63 Å, Study on the structure and function of tumor suppressor ZMYND11
9LOA 1.8 Å, Structural insights into the tumor suppressor ZMYND11 reveal diverse recognition…
9M0U 1.89 Å, Structural insights into the tumor suppressor ZMYND11 reveal diverse recognition…
5HDA 2.39 Å, Crystal Structure of the BS69 coiled coil-MYND domains bound to an EBNA2 PXLXP motif
9LP4 2.96 Å, Structural insights into the Tumor suppressor ZMYND11 reveal diverse recognition…
9VC7 3.35 Å, Structural insights into the tumor suppressor ZMYND11 reveal diverse recognition…

Browse structure collections

About this viewer

MolViewer shows 4NS5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.