Structural insights into the tumor suppressor ZMYND11 reveal diverse recognition mechanisms. Determined by X-ray diffraction at 1.89 Å resolution. Released 14 Jan 2026.
Explore 9M0U in 3D Show helices and sheets RCSB PDB PDBe
9M0U contains 8 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 94 | 1 | 1 |
| α-helix | 95-97 | 3 | |
| α-helix | 99-101 | 3 | |
| β-strand | 102 | 1 | 2 |
| β-strand | 109 | 1 | 2 |
| β-strand | 112-114 | 3 | 3 |
| β-strand | 121-123 | 3 | 3 |
| α-helix | 124-126 | 3 | |
| α-helix | 129-132 | 4 | |
| β-strand | 133 | 1 | 1 |
| α-helix | 143-150 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 102 | 1 | 4 |
| β-strand | 109 | 1 | 4 |
| β-strand | 112-114 | 3 | 5 |
| β-strand | 121-123 | 3 | 5 |
| α-helix | 124-126 | 3 | |
| α-helix | 129-131 | 3 | |
| α-helix | 143-147 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger MYND domain-containing protein 11 | A, B | protein | 62 | Homo sapiens | Q15326 (AlphaFold model) |
>9M0U_1 Zinc finger MYND domain-containing protein 11 (chains A, B) DEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIK KK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Water and common crystallization additives (MPD, ACT) are not listed.
Novel intermolecular zinc fingers and redox-driven conformational changes dictate tumor suppressor ZMYND11's role in cooperative recognition of diverse targets. Bai, X., Zhang, J., Wang, S. et al. Nucleic Acids Res (2026) 54. DOI 10.1093/nar/gkag048 · PubMed
Other PDB entries of the same protein (UniProt Q15326 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9M0U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.