Structural Insights into the Tumor Suppressor ZMYND11 Reveal Diverse Recognition Mechanisms. Determined by X-ray diffraction at 1.63 Å resolution. Released 13 Aug 2025.
Explore 8XU6 in 3D Show helices and sheets RCSB PDB PDBe
8XU6 contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 98-103 | 6 | 1 |
| β-strand | 108-114 | 7 | 1 |
| β-strand | 121-123 | 3 | 1 |
| α-helix | 124-126 | 3 | |
| α-helix | 129-132 | 4 | |
| α-helix | 143-147 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger MYND domain-containing protein 11 | A | protein | 54 | Homo sapiens | Q15326 (AlphaFold model) |
>8XU6_1 Zinc finger MYND domain-containing protein 11 (chains A) GSMDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Structural Insights into the Tumor Suppressor ZMYND11 Reveal Diverse Recognition Mechanisms. Bai, X., Chen, Z. To be published.
Other PDB entries of the same protein (UniProt Q15326 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8XU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.