Study on the structure and function of tumor suppressor ZMYND11. Determined by X-ray diffraction at 1.63 Å resolution. Released 21 Jan 2026.
Explore 9LOM in 3D Show helices and sheets RCSB PDB PDBe
9LOM contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 98-103 | 6 | 1 |
| β-strand | 108-114 | 7 | 1 |
| β-strand | 121-123 | 3 | 1 |
| α-helix | 124-126 | 3 | |
| α-helix | 129-132 | 4 | |
| α-helix | 143-147 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger MYND domain-containing protein 11 | A | protein | 54 | Homo sapiens | Q15326 (AlphaFold model) |
>9LOM_1 Zinc finger MYND domain-containing protein 11 (chains A) GSMDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Novel intermolecular zinc fingers and redox-driven conformational changes dictate tumor suppressor ZMYND11's role in cooperative recognition of diverse targets. Bai, X., Zhang, J., Wang, S. et al. Nucleic Acids Res (2026) 54. DOI 10.1093/nar/gkag048 · PubMed
Other PDB entries of the same protein (UniProt Q15326 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9LOM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.