4O9Y: TcdA1

Name: PDB 4O9Y: Crystal Structure of TcdA1
Published: 2014-02-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal Structure of TcdA1. Determined by X-ray diffraction at 3.5 Å resolution. Released 26 Feb 2014.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Photorhabdus luminescens
Chains: 10
Atoms: 197,663
Mol. weight: 2832.29 kDa
Released: 26 Feb 2014

Explore 4O9Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4O9Y contains 1,144 α-helices and 1,006 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 113 helices, 98 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6
α-helix	29-35	7
α-helix	43-69	27
α-helix	72-76	5
α-helix	86-95	10
α-helix	103	1
β-strand	104	1	1
α-helix	105	1
β-strand	111	1	2
α-helix	115-126	12
α-helix	127-129	3
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	3
α-helix	152-156	5
β-strand	160	1	4
α-helix	163-176	14
α-helix	182-191	10
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-296	7
β-strand	300	1	5
β-strand	306	1	5
β-strand	309	1	6
β-strand	312-319	8	6
β-strand	324-336	13	6
β-strand	341-349	9	7
β-strand	352-359	8	7
β-strand	367-371	5	6
β-strand	377-381	5	6
α-helix	384-385	2
β-strand	390-396	7	7
α-helix	399-402	4
β-strand	406-414	9	6
β-strand	418-432	15	6
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-498	7
α-helix	501-504	4
β-strand	508	1	8
β-strand	511	1	8
α-helix	512-513	2
α-helix	514-519	6
β-strand	536-537	2	9
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-578	2	9
α-helix	582-597	16
α-helix	602-612	11
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	835-839	5
α-helix	843-855	13
α-helix	871-886	16
α-helix	891-899	9
α-helix	909-911	3
α-helix	912-924	13
α-helix	928-952	25
α-helix	964-971	8
β-strand	982	1	4
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1055-1064	10
α-helix	1071-1089	19
β-strand	1091-1098	8	10
β-strand	1107-1114	8	10
β-strand	1120-1127	8	10
β-strand	1141	1	10
β-strand	1145-1146	2	10
β-strand	1159-1163	5	11
β-strand	1166-1179	14	11
β-strand	1191-1202	12	11
β-strand	1203	1	12
α-helix	1208	1
β-strand	1209	1	12
α-helix	1210-1212	3
β-strand	1213-1216	4	11
α-helix	1218-1223	6
β-strand	1234-1238	5	13
β-strand	1239	1	14
β-strand	1245-1249	5	13
β-strand	1265-1269	5	13
β-strand	1275-1278	4	13
α-helix	1279	1
α-helix	1280-1289	10
α-helix	1303	1
β-strand	1304	1	10
α-helix	1305	1
β-strand	1306	1	14
β-strand	1310-1311	2	15
β-strand	1316	1	16
β-strand	1321-1323	3	15
β-strand	1331	1	17
β-strand	1337	1	16
β-strand	1340-1345	6	18
β-strand	1348-1353	6	18
β-strand	1356-1359	4	19
β-strand	1360	1	17
α-helix	1363	1
α-helix	1367-1378	12
β-strand	1384-1392	9	20
β-strand	1405-1410	6	20
β-strand	1420-1425	6	20
β-strand	1432-1437	6	20
β-strand	1444-1450	7	20
β-strand	1454-1458	5	20
α-helix	1466-1468	3
β-strand	1471-1475	5	20
β-strand	1480-1490	11	20
β-strand	1499-1504	6	15
β-strand	1507-1512	6	15
α-helix	1513-1516	4
β-strand	1517	1	21
α-helix	1521-1523	3
β-strand	1528-1531	4	19
β-strand	1532	1	21
β-strand	1535-1539	5	18
α-helix	1541	1
α-helix	1543-1544	2
β-strand	1545	1	15
β-strand	1548-1558	11	15
β-strand	1564-1576	13	15
β-strand	1585-1587	3	22
β-strand	1595-1598	4	22
β-strand	1601-1604	4	22
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
β-strand	1633-1635	3	23
β-strand	1641-1647	7	24
β-strand	1661-1666	6	25
β-strand	1673-1679	7	25
β-strand	1686-1692	7	24
β-strand	1705-1711	7	25
β-strand	1724-1728	5	25
β-strand	1732-1735	4	25
β-strand	1746-1750	5	24
β-strand	1755-1757	3	23
α-helix	1758-1759	2
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1784	10
α-helix	1789-1797	9
β-strand	1800	1	26
β-strand	1806-1807	2	27
β-strand	1810-1811	2	27
β-strand	1816	1	26
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	3
α-helix	1907-1910	4
α-helix	1913-1927	15
α-helix	1948	1
β-strand	1949	1	2
α-helix	1950	1
β-strand	1951	1	1
α-helix	1954-1971	18
α-helix	1983-1985	3
α-helix	1993-1995	3
α-helix	2009-2012	4
β-strand	2017	1	28
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2306-2324	19
β-strand	2329-2336	8	29
α-helix	2337-2342	6
α-helix	2353-2362	10
β-strand	2367-2368	2	30
β-strand	2375-2377	3	30
β-strand	2387-2392	6	30
α-helix	2393-2396	4
α-helix	2398-2401	4
β-strand	2410-2418	9	29
β-strand	2431-2435	5	30
β-strand	2448-2450	3	30
β-strand	2456-2457	2	29
β-strand	2468	1	28
α-helix	2469-2470	2
β-strand	2475-2476	2	29
β-strand	2481-2486	6	30
α-helix	2498-2503	6
β-strand	2508-2515	8	29

Chain B: 118 helices, 97 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6
α-helix	29-35	7
α-helix	43-69	27
α-helix	72-76	5
α-helix	86-95	10
α-helix	103	1
β-strand	104	1	31
α-helix	105	1
β-strand	111	1	32
α-helix	115-126	12
α-helix	127-129	3
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	33
α-helix	152-156	5
β-strand	160	1	34
α-helix	163-176	14
α-helix	182-191	10
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	257-267	11
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-296	7
β-strand	300	1	35
β-strand	306	1	35
β-strand	312-319	8	36
β-strand	324-336	13	36
β-strand	341-349	9	37
β-strand	352-359	8	37
β-strand	367-371	5	36
β-strand	377-381	5	36
α-helix	384-385	2
β-strand	390-396	7	37
α-helix	399-403	5
β-strand	406-414	9	36
β-strand	418-432	15	36
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-498	7
α-helix	501-504	4
α-helix	511-513	3
α-helix	514-519	6
β-strand	536-537	2	38
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-578	2	38
α-helix	582-597	16
α-helix	602-612	11
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	748-769	22
α-helix	773-781	9
α-helix	783-786	4
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	835-838	4
α-helix	843-855	13
α-helix	871-886	16
α-helix	891-899	9
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-924	13
α-helix	928-952	25
α-helix	964-971	8
β-strand	982	1	34
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
β-strand	1046	1	39
β-strand	1049	1	39
α-helix	1055-1063	9
α-helix	1071-1089	19
β-strand	1091-1098	8	40
β-strand	1107-1114	8	40
β-strand	1121-1122	2	40
β-strand	1123	1	41
β-strand	1125-1127	3	40
β-strand	1145	1	41
β-strand	1159-1163	5	42
β-strand	1166-1179	14	42
β-strand	1191-1202	12	42
β-strand	1203	1	43
α-helix	1208	1
β-strand	1209	1	43
α-helix	1210-1212	3
β-strand	1213-1216	4	42
α-helix	1218-1223	6
β-strand	1234-1238	5	44
β-strand	1239	1	45
β-strand	1245-1249	5	44
β-strand	1265-1269	5	44
β-strand	1275-1277	3	44
α-helix	1278-1279	2
α-helix	1280-1289	10
α-helix	1303	1
β-strand	1304	1	40
α-helix	1305	1
β-strand	1306	1	45
β-strand	1310-1311	2	46
β-strand	1316	1	47
β-strand	1323	1	46
β-strand	1331	1	48
β-strand	1337	1	47
β-strand	1340-1345	6	49
β-strand	1348-1353	6	49
β-strand	1356-1359	4	50
β-strand	1360	1	48
α-helix	1363-1364	2
α-helix	1367-1378	12
β-strand	1384-1392	9	51
β-strand	1405-1410	6	51
β-strand	1420-1425	6	51
β-strand	1432-1437	6	51
β-strand	1444-1450	7	51
β-strand	1454-1458	5	51
α-helix	1459	1
α-helix	1466-1468	3
β-strand	1471-1475	5	51
β-strand	1480-1490	11	51
β-strand	1499-1504	6	46
β-strand	1507-1510	4	46
α-helix	1513-1516	4
α-helix	1521-1523	3
β-strand	1528-1531	4	50
β-strand	1535-1539	5	49
α-helix	1541	1
α-helix	1543-1544	2
β-strand	1545	1	46
β-strand	1548-1558	11	46
β-strand	1564-1576	13	46
α-helix	1577-1578	2
α-helix	1582-1584	3
β-strand	1585-1588	4	52
β-strand	1594-1598	5	52
β-strand	1601-1604	4	52
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
β-strand	1633-1635	3	53
β-strand	1642-1647	6	54
β-strand	1660-1666	7	55
β-strand	1674-1680	7	55
β-strand	1686-1691	6	54
β-strand	1705-1711	7	55
β-strand	1714	1	55
β-strand	1724-1728	5	55
β-strand	1732-1735	4	55
β-strand	1746-1750	5	54
β-strand	1755-1757	3	53
α-helix	1758-1759	2
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1784	10
α-helix	1789-1797	9
β-strand	1800	1	56
β-strand	1806-1807	2	57
β-strand	1810-1811	2	57
β-strand	1816	1	56
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	33
α-helix	1907-1910	4
α-helix	1913-1927	15
α-helix	1943-1945	3
α-helix	1948	1
β-strand	1949	1	32
α-helix	1950	1
β-strand	1951	1	31
α-helix	1954-1971	18
α-helix	1983-1985	3
α-helix	1992-1994	3
α-helix	2009-2012	4
β-strand	2017	1	58
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2306-2324	19
β-strand	2329-2336	8	59
α-helix	2337-2343	7
α-helix	2353-2362	10
β-strand	2367-2368	2	60
β-strand	2375-2377	3	60
β-strand	2387-2392	6	60
α-helix	2393-2396	4
α-helix	2398-2400	3
β-strand	2410-2418	9	59
β-strand	2431-2435	5	60
β-strand	2447-2450	4	60
β-strand	2456-2457	2	59
β-strand	2468	1	58
α-helix	2469-2470	2
β-strand	2475-2476	2	59
β-strand	2481-2486	6	60
α-helix	2498-2502	5
β-strand	2508-2515	8	59

Chain C: 112 helices, 104 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6
α-helix	29-36	8
α-helix	43-69	27
α-helix	72-76	5
α-helix	86-95	10
α-helix	103	1
β-strand	104	1	61
α-helix	105	1
β-strand	111	1	62
α-helix	115-126	12
α-helix	127-129	3
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	63
α-helix	152-156	5
β-strand	160	1	64
α-helix	163-176	14
α-helix	182-191	10
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-296	7
β-strand	300	1	65
β-strand	306	1	65
β-strand	309	1	66
β-strand	312-319	8	66
β-strand	324-336	13	66
β-strand	342-349	8	67
β-strand	352-358	7	67
β-strand	367-371	5	66
β-strand	377-381	5	66
α-helix	384-385	2
β-strand	391-396	6	67
α-helix	399-403	5
β-strand	406-414	9	66
β-strand	418-432	15	66
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-498	7
α-helix	501-504	4
β-strand	508	1	68
β-strand	511	1	68
α-helix	512-513	2
α-helix	514-519	6
β-strand	536-537	2	69
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-578	2	69
α-helix	582-597	16
α-helix	602-612	11
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	834-839	6
α-helix	843-855	13
α-helix	871-886	16
α-helix	891-899	9
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-924	13
α-helix	928-952	25
α-helix	964-971	8
β-strand	982	1	64
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1055-1063	9
α-helix	1071-1089	19
β-strand	1091-1098	8	70
β-strand	1107-1114	8	70
β-strand	1119	1	71
β-strand	1120-1122	3	70
β-strand	1123	1	72
β-strand	1125-1127	3	70
β-strand	1145	1	72
β-strand	1151	1	71
β-strand	1159-1163	5	73
β-strand	1166-1179	14	73
β-strand	1191-1202	12	73
β-strand	1203	1	74
α-helix	1208	1
β-strand	1209	1	74
α-helix	1210-1212	3
β-strand	1213-1216	4	73
α-helix	1218-1223	6
β-strand	1233-1238	6	75
β-strand	1239	1	76
α-helix	1244	1
β-strand	1245-1250	6	75
β-strand	1265-1269	5	75
β-strand	1275-1278	4	75
α-helix	1279	1
α-helix	1280-1289	10
α-helix	1303	1
β-strand	1304	1	70
α-helix	1305	1
β-strand	1306	1	76
β-strand	1310-1311	2	77
β-strand	1316	1	78
β-strand	1321-1323	3	77
β-strand	1324	1	79
β-strand	1331	1	79
β-strand	1337	1	78
β-strand	1340-1345	6	80
β-strand	1348-1353	6	80
β-strand	1356-1359	4	81
β-strand	1360	1	79
α-helix	1363-1364	2
α-helix	1367-1378	12
β-strand	1384-1392	9	82
β-strand	1405-1410	6	82
β-strand	1420-1425	6	82
β-strand	1432-1437	6	82
β-strand	1444-1450	7	82
β-strand	1454-1459	6	82
α-helix	1466-1468	3
β-strand	1471-1475	5	82
β-strand	1480-1490	11	82
β-strand	1499-1504	6	77
β-strand	1507-1512	6	77
α-helix	1513-1516	4
β-strand	1517	1	83
α-helix	1520-1523	4
β-strand	1528-1531	4	81
β-strand	1532	1	83
β-strand	1535-1539	5	80
α-helix	1541	1
α-helix	1543-1544	2
β-strand	1545	1	77
β-strand	1548-1558	11	77
β-strand	1564-1576	13	77
β-strand	1585-1587	3	84
β-strand	1595-1598	4	84
β-strand	1601-1604	4	84
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
β-strand	1633-1634	2	85
β-strand	1642-1647	6	86
β-strand	1661-1666	6	87
β-strand	1674-1679	6	87
β-strand	1686-1691	6	86
β-strand	1705-1711	7	87
β-strand	1724-1728	5	87
β-strand	1732-1736	5	87
β-strand	1746-1750	5	86
β-strand	1756-1757	2	85
α-helix	1758-1759	2
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	88
β-strand	1806-1807	2	89
β-strand	1810-1811	2	89
β-strand	1816	1	88
α-helix	1819-1822	4
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	63
α-helix	1907-1910	4
α-helix	1913-1928	16
α-helix	1948	1
β-strand	1949	1	62
α-helix	1950	1
β-strand	1951	1	61
α-helix	1954-1971	18
β-strand	1974	1	90
β-strand	1980	1	90
α-helix	1983-1987	5
α-helix	2009-2012	4
β-strand	2017	1	91
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2306-2324	19
β-strand	2329-2336	8	92
α-helix	2337-2343	7
α-helix	2353-2362	10
β-strand	2368	1	93
β-strand	2375-2377	3	93
β-strand	2387-2392	6	93
α-helix	2398-2400	3
β-strand	2410-2418	9	92
β-strand	2431-2435	5	93
β-strand	2448-2450	3	93
β-strand	2456-2457	2	92
β-strand	2468	1	91
α-helix	2469-2470	2
β-strand	2475-2476	2	92
β-strand	2481-2486	6	93
α-helix	2498-2503	6
β-strand	2508-2515	8	92

Chain D: 114 helices, 101 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6
α-helix	29-35	7
α-helix	43-69	27
α-helix	72-76	5
α-helix	86-95	10
α-helix	103	1
β-strand	104	1	94
α-helix	105	1
β-strand	111	1	95
α-helix	115-126	12
α-helix	127-129	3
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	96
α-helix	152-156	5
β-strand	160	1	97
α-helix	163-176	14
α-helix	182-191	10
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-296	7
β-strand	300	1	98
β-strand	306	1	98
β-strand	309	1	99
β-strand	312-319	8	99
β-strand	324-336	13	99
β-strand	341-349	9	100
β-strand	352-359	8	100
β-strand	367-371	5	99
β-strand	377-381	5	99
α-helix	384-385	2
β-strand	390-396	7	100
α-helix	399-403	5
β-strand	406-414	9	99
β-strand	418-432	15	99
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-498	7
α-helix	501-504	4
β-strand	508	1	101
β-strand	511	1	101
α-helix	512-513	2
α-helix	514-519	6
β-strand	536-537	2	102
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-578	2	102
α-helix	582-597	16
α-helix	602-612	11
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-697	10
α-helix	705-718	14
α-helix	727-737	11
α-helix	748-769	22
α-helix	773-781	9
α-helix	783-786	4
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	835-839	5
α-helix	843-855	13
α-helix	871-886	16
α-helix	891-899	9
α-helix	909-911	3
α-helix	912-924	13
α-helix	928-952	25
α-helix	964-971	8
β-strand	982	1	97
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1055-1063	9
α-helix	1071-1089	19
β-strand	1091-1098	8	103
β-strand	1107-1114	8	103
β-strand	1120-1122	3	103
β-strand	1123	1	104
β-strand	1125-1127	3	103
β-strand	1145	1	104
β-strand	1159-1163	5	105
β-strand	1166-1179	14	105
β-strand	1191-1202	12	105
β-strand	1203	1	106
β-strand	1209	1	106
α-helix	1211-1212	2
β-strand	1213-1215	3	105
α-helix	1218-1223	6
β-strand	1233-1238	6	107
β-strand	1239	1	108
β-strand	1245-1250	6	107
β-strand	1265-1269	5	107
β-strand	1275-1278	4	107
α-helix	1279	1
α-helix	1280-1289	10
α-helix	1303-1305	3
β-strand	1306	1	108
β-strand	1310-1311	2	109
β-strand	1316	1	110
β-strand	1323	1	109
β-strand	1331	1	111
β-strand	1337	1	110
β-strand	1340-1345	6	112
β-strand	1348-1353	6	112
β-strand	1356-1359	4	113
β-strand	1360	1	111
α-helix	1363	1
α-helix	1367-1378	12
β-strand	1384-1392	9	114
β-strand	1405-1410	6	114
β-strand	1420-1425	6	114
β-strand	1432-1437	6	114
β-strand	1444-1450	7	114
β-strand	1454-1458	5	114
α-helix	1459	1
α-helix	1466-1468	3
β-strand	1471-1475	5	114
β-strand	1480-1490	11	114
β-strand	1493	1	115
β-strand	1499-1504	6	109
β-strand	1507-1510	4	109
α-helix	1513-1516	4
β-strand	1517	1	116
α-helix	1521-1523	3
β-strand	1528-1531	4	113
β-strand	1532	1	116
β-strand	1535-1539	5	112
α-helix	1541	1
α-helix	1543-1544	2
β-strand	1545	1	109
β-strand	1548-1558	11	109
β-strand	1559	1	115
β-strand	1564-1576	13	109
α-helix	1582-1584	3
β-strand	1585-1588	4	117
β-strand	1594-1598	5	117
β-strand	1601-1604	4	117
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
β-strand	1633-1635	3	118
β-strand	1642-1647	6	119
β-strand	1661-1666	6	120
β-strand	1674-1679	6	120
β-strand	1686-1691	6	119
β-strand	1705-1711	7	120
β-strand	1714	1	120
β-strand	1724-1728	5	120
β-strand	1732-1735	4	120
β-strand	1746-1750	5	119
β-strand	1755-1757	3	118
α-helix	1758-1759	2
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1784	10
α-helix	1789-1797	9
β-strand	1800	1	121
β-strand	1806-1807	2	122
β-strand	1810-1811	2	122
β-strand	1816	1	121
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	96
α-helix	1907-1910	4
α-helix	1913-1928	16
α-helix	1943-1945	3
α-helix	1948	1
β-strand	1949	1	95
α-helix	1950	1
β-strand	1951	1	94
α-helix	1954-1971	18
α-helix	1983-1985	3
α-helix	1992-1994	3
α-helix	2009-2012	4
β-strand	2017	1	123
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2306-2324	19
β-strand	2329-2336	8	124
α-helix	2337-2342	6
α-helix	2353-2362	10
β-strand	2367-2368	2	125
β-strand	2375-2377	3	125
β-strand	2387-2392	6	125
α-helix	2393-2396	4
α-helix	2398-2400	3
β-strand	2410-2418	9	124
β-strand	2431-2435	5	125
β-strand	2448-2450	3	125
β-strand	2456-2457	2	124
β-strand	2468	1	123
α-helix	2469-2470	2
β-strand	2476	1	124
β-strand	2481-2486	6	125
α-helix	2498-2503	6
β-strand	2508-2515	8	124

Chain E: 113 helices, 98 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6
α-helix	29-35	7
α-helix	43-69	27
α-helix	72-76	5
α-helix	86-95	10
α-helix	103	1
β-strand	104	1	126
α-helix	105	1
β-strand	111	1	127
α-helix	115-126	12
α-helix	127-129	3
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	128
α-helix	152-156	5
β-strand	160	1	129
α-helix	163-176	14
α-helix	182-191	10
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-296	7
β-strand	300	1	130
β-strand	306	1	130
β-strand	309	1	131
β-strand	312-319	8	131
β-strand	324-336	13	131
β-strand	341-349	9	132
β-strand	352-359	8	132
β-strand	367-371	5	131
β-strand	377-381	5	131
α-helix	384-385	2
β-strand	391-396	6	132
α-helix	399-403	5
β-strand	407-413	7	131
β-strand	419-432	14	131
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-498	7
α-helix	501-504	4
β-strand	508	1	133
β-strand	511	1	133
α-helix	512-513	2
α-helix	514-518	5
β-strand	536-537	2	134
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-578	2	134
α-helix	582-597	16
α-helix	602-612	11
α-helix	624-643	20
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	834-839	6
α-helix	843-855	13
α-helix	871-886	16
α-helix	891-899	9
α-helix	909-911	3
α-helix	912-924	13
α-helix	928-952	25
α-helix	964-971	8
β-strand	982	1	129
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1037	10
α-helix	1055-1063	9
α-helix	1071-1089	19
β-strand	1091-1098	8	135
β-strand	1107-1114	8	135
β-strand	1120-1127	8	135
β-strand	1145-1146	2	135
β-strand	1159-1163	5	136
β-strand	1166-1179	14	136
β-strand	1191-1202	12	136
β-strand	1203	1	137
α-helix	1208	1
β-strand	1209	1	137
α-helix	1210-1212	3
β-strand	1213-1216	4	136
α-helix	1218-1223	6
β-strand	1234-1238	5	138
β-strand	1239	1	139
β-strand	1245-1249	5	138
β-strand	1265-1269	5	138
β-strand	1275-1277	3	138
α-helix	1278-1279	2
α-helix	1280-1289	10
α-helix	1303-1305	3
β-strand	1306	1	139
β-strand	1310-1311	2	140
β-strand	1316	1	141
β-strand	1323	1	140
β-strand	1324	1	142
β-strand	1331	1	142
β-strand	1337	1	141
β-strand	1340-1345	6	143
β-strand	1348-1353	6	143
β-strand	1356-1359	4	144
β-strand	1360	1	142
α-helix	1363	1
α-helix	1367-1378	12
β-strand	1384-1392	9	145
β-strand	1405-1410	6	145
β-strand	1420-1425	6	145
β-strand	1432-1437	6	145
β-strand	1444-1450	7	145
β-strand	1454-1458	5	145
α-helix	1466-1468	3
β-strand	1471-1475	5	145
β-strand	1480-1490	11	145
β-strand	1499-1504	6	140
β-strand	1507-1512	6	140
α-helix	1513-1516	4
β-strand	1517	1	146
α-helix	1521-1523	3
β-strand	1528-1531	4	144
β-strand	1532	1	146
β-strand	1535-1539	5	143
α-helix	1541	1
α-helix	1543-1544	2
β-strand	1545	1	140
β-strand	1548-1558	11	140
β-strand	1564-1576	13	140
α-helix	1582-1584	3
β-strand	1585-1588	4	147
β-strand	1594-1598	5	147
β-strand	1601-1604	4	147
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
β-strand	1633-1635	3	148
β-strand	1642-1647	6	149
β-strand	1661-1666	6	150
β-strand	1674-1679	6	150
β-strand	1686-1691	6	149
β-strand	1705-1711	7	150
β-strand	1714	1	150
β-strand	1724-1728	5	150
β-strand	1732-1736	5	150
β-strand	1746-1750	5	149
β-strand	1755-1757	3	148
α-helix	1758-1759	2
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1784	10
α-helix	1789-1797	9
β-strand	1800	1	151
β-strand	1806-1807	2	152
β-strand	1810-1811	2	152
β-strand	1816	1	151
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1869	24
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	128
α-helix	1907-1910	4
α-helix	1913-1928	16
α-helix	1948	1
β-strand	1949	1	127
α-helix	1950	1
β-strand	1951	1	126
α-helix	1954-1971	18
α-helix	1983-1985	3
α-helix	1992-1994	3
α-helix	2009-2012	4
β-strand	2017	1	153
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2306-2324	19
β-strand	2329-2336	8	154
α-helix	2337-2343	7
α-helix	2353-2362	10
β-strand	2367-2368	2	155
β-strand	2375-2377	3	155
β-strand	2387-2391	5	155
α-helix	2393-2396	4
α-helix	2398-2400	3
β-strand	2410-2418	9	154
β-strand	2431-2435	5	155
β-strand	2448-2450	3	155
β-strand	2456-2457	2	154
β-strand	2468	1	153
α-helix	2469-2470	2
β-strand	2476	1	154
β-strand	2482-2486	5	155
α-helix	2498-2502	5
β-strand	2508-2515	8	154

Chain F: 114 helices, 104 β-strands

Element	Residues	Length	Sheet
α-helix	19-23	5
α-helix	29-35	7
α-helix	43-69	27
α-helix	72-76	5
α-helix	86-95	10
α-helix	103	1
β-strand	104	1	156
α-helix	105	1
β-strand	111	1	157
α-helix	115-126	12
α-helix	127-129	3
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	158
α-helix	152-156	5
β-strand	160	1	159
α-helix	163-176	14
α-helix	182-191	10
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-296	7
β-strand	300	1	160
β-strand	306	1	160
β-strand	309	1	161
β-strand	312-319	8	161
β-strand	324-336	13	161
β-strand	341-349	9	162
β-strand	352-359	8	162
β-strand	367-371	5	161
β-strand	377-381	5	161
α-helix	384-385	2
β-strand	390-396	7	162
α-helix	399-403	5
β-strand	406-414	9	161
β-strand	418-432	15	161
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-498	7
α-helix	501-504	4
β-strand	508	1	163
β-strand	511	1	163
α-helix	512-513	2
α-helix	514-519	6
β-strand	536-537	2	164
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-578	2	164
α-helix	582-597	16
α-helix	602-612	11
α-helix	624-643	20
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-697	10
α-helix	705-718	14
α-helix	727-737	11
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	835-838	4
α-helix	843-855	13
α-helix	871-886	16
α-helix	891-899	9
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-924	13
α-helix	928-952	25
α-helix	964-971	8
β-strand	982	1	159
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1055-1063	9
α-helix	1071-1089	19
β-strand	1091-1098	8	165
β-strand	1107-1114	8	165
β-strand	1120-1122	3	165
β-strand	1123	1	166
β-strand	1125-1127	3	165
β-strand	1145	1	166
β-strand	1159-1163	5	167
β-strand	1166-1179	14	167
β-strand	1191-1202	12	167
β-strand	1203	1	168
α-helix	1208	1
β-strand	1209	1	168
α-helix	1210-1212	3
β-strand	1213-1215	3	167
α-helix	1218-1222	5
β-strand	1234-1238	5	169
β-strand	1239	1	170
α-helix	1244	1
β-strand	1245-1249	5	169
β-strand	1265-1269	5	169
β-strand	1275-1277	3	169
α-helix	1278-1279	2
α-helix	1280-1289	10
α-helix	1303	1
β-strand	1304	1	165
α-helix	1305	1
β-strand	1306	1	170
β-strand	1310-1311	2	171
β-strand	1316	1	172
β-strand	1323	1	171
β-strand	1324	1	173
β-strand	1331	1	173
β-strand	1337	1	172
β-strand	1340-1344	5	174
β-strand	1349-1353	5	174
β-strand	1356-1359	4	175
β-strand	1360	1	173
α-helix	1363-1364	2
α-helix	1367-1378	12
β-strand	1384-1392	9	176
β-strand	1405-1410	6	176
β-strand	1420-1425	6	176
β-strand	1432	1	177
β-strand	1434-1437	4	176
β-strand	1444-1446	3	176
β-strand	1450	1	177
β-strand	1454-1458	5	176
α-helix	1466-1468	3
β-strand	1471-1475	5	176
β-strand	1480-1490	11	176
β-strand	1493	1	178
β-strand	1499-1504	6	171
β-strand	1507-1510	4	171
α-helix	1513-1516	4
β-strand	1517	1	179
α-helix	1521-1523	3
β-strand	1528-1531	4	175
β-strand	1532	1	179
β-strand	1535-1539	5	174
α-helix	1541	1
α-helix	1543-1544	2
β-strand	1545	1	171
β-strand	1548-1558	11	171
β-strand	1559	1	178
β-strand	1564-1576	13	171
β-strand	1585-1586	2	180
β-strand	1595-1598	4	180
β-strand	1601-1604	4	180
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
β-strand	1633-1635	3	181
β-strand	1641-1647	7	182
β-strand	1661-1666	6	183
β-strand	1674-1679	6	183
β-strand	1686-1692	7	182
β-strand	1705-1711	7	183
β-strand	1724-1728	5	183
β-strand	1732-1735	4	183
β-strand	1746-1750	5	182
β-strand	1755-1757	3	181
α-helix	1758-1759	2
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	184
β-strand	1806-1807	2	185
β-strand	1810-1811	2	185
β-strand	1816	1	184
α-helix	1819-1822	4
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	158
α-helix	1907-1910	4
α-helix	1913-1927	15
α-helix	1948	1
β-strand	1949	1	157
α-helix	1950	1
β-strand	1951	1	156
α-helix	1954-1971	18
α-helix	1983-1987	5
α-helix	1992-1994	3
α-helix	2009-2012	4
β-strand	2017	1	186
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2306-2324	19
β-strand	2329-2336	8	187
α-helix	2337-2343	7
α-helix	2353-2362	10
β-strand	2367-2368	2	188
β-strand	2375-2377	3	188
β-strand	2387-2392	6	188
α-helix	2393-2396	4
α-helix	2398-2401	4
β-strand	2410-2418	9	187
β-strand	2431-2435	5	188
β-strand	2448-2450	3	188
β-strand	2456-2457	2	187
β-strand	2468	1	186
α-helix	2469-2470	2
β-strand	2475-2476	2	187
β-strand	2481-2486	6	188
α-helix	2498-2503	6
β-strand	2508-2515	8	187

Chain G: 114 helices, 104 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6
α-helix	29-35	7
α-helix	43-69	27
α-helix	72-76	5
α-helix	86-95	10
α-helix	103	1
β-strand	104	1	189
α-helix	105	1
β-strand	111	1	190
α-helix	115-126	12
α-helix	127-129	3
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	191
α-helix	152-156	5
β-strand	160	1	192
α-helix	163-176	14
α-helix	182-191	10
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-296	7
β-strand	300	1	193
β-strand	306	1	193
β-strand	309	1	194
β-strand	312-319	8	194
β-strand	324-336	13	194
β-strand	343-349	7	195
β-strand	352-357	6	195
β-strand	367-371	5	194
β-strand	377-381	5	194
α-helix	384-385	2
β-strand	391-396	6	195
α-helix	399-403	5
β-strand	406-414	9	194
β-strand	418-432	15	194
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-497	6
α-helix	501-504	4
β-strand	508	1	196
β-strand	511	1	196
α-helix	512-513	2
α-helix	514-519	6
β-strand	536-537	2	197
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-578	2	197
α-helix	582-597	16
α-helix	602-612	11
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-697	10
α-helix	705-718	14
α-helix	727-737	11
α-helix	748-769	22
α-helix	773-781	9
α-helix	783-786	4
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	834-839	6
α-helix	843-855	13
α-helix	871-886	16
α-helix	891-899	9
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-924	13
α-helix	928-952	25
α-helix	964-971	8
β-strand	982	1	192
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1055-1063	9
α-helix	1071-1089	19
β-strand	1091-1098	8	198
β-strand	1107-1114	8	198
β-strand	1121-1122	2	198
β-strand	1123	1	199
β-strand	1125-1127	3	198
β-strand	1145	1	199
β-strand	1159-1163	5	200
β-strand	1166-1179	14	200
β-strand	1191-1202	12	200
β-strand	1203	1	201
α-helix	1208	1
β-strand	1209	1	201
α-helix	1210-1212	3
β-strand	1213-1216	4	200
α-helix	1218-1223	6
β-strand	1234-1238	5	202
β-strand	1239	1	203
β-strand	1245-1249	5	202
β-strand	1265-1269	5	202
β-strand	1275-1277	3	202
α-helix	1278-1279	2
α-helix	1280-1289	10
α-helix	1303	1
β-strand	1304	1	198
α-helix	1305	1
β-strand	1306	1	203
β-strand	1310-1311	2	204
β-strand	1316	1	205
β-strand	1321-1323	3	204
β-strand	1331	1	206
β-strand	1337	1	205
β-strand	1340-1345	6	207
β-strand	1348-1353	6	207
β-strand	1356-1359	4	208
β-strand	1360	1	206
α-helix	1363-1364	2
α-helix	1367-1378	12
β-strand	1384-1392	9	209
β-strand	1405-1410	6	209
β-strand	1420-1425	6	209
β-strand	1432-1437	6	209
β-strand	1444-1450	7	209
β-strand	1454-1458	5	209
α-helix	1466-1468	3
β-strand	1471-1475	5	209
β-strand	1480-1490	11	209
β-strand	1493	1	210
β-strand	1499-1504	6	204
β-strand	1507-1510	4	204
α-helix	1513-1516	4
β-strand	1517	1	211
α-helix	1521-1523	3
β-strand	1528-1531	4	208
β-strand	1532	1	211
β-strand	1535-1539	5	207
α-helix	1541	1
α-helix	1543-1544	2
β-strand	1545	1	204
β-strand	1548-1558	11	204
β-strand	1559	1	210
β-strand	1564-1576	13	204
α-helix	1582-1584	3
β-strand	1585-1588	4	212
β-strand	1594-1598	5	212
β-strand	1601-1604	4	212
α-helix	1609-1618	10
α-helix	1621-1624	4
α-helix	1627-1630	4
β-strand	1633-1634	2	213
β-strand	1641-1647	7	214
β-strand	1660-1666	7	215
β-strand	1674-1680	7	215
β-strand	1686-1692	7	214
β-strand	1705-1711	7	215
β-strand	1714	1	215
β-strand	1724-1728	5	215
β-strand	1732-1735	4	215
β-strand	1746-1750	5	214
β-strand	1756-1757	2	213
α-helix	1758-1759	2
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1784	10
α-helix	1789-1797	9
β-strand	1800	1	216
β-strand	1806-1807	2	217
β-strand	1810-1811	2	217
β-strand	1816	1	216
α-helix	1819-1822	4
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	191
α-helix	1907-1910	4
α-helix	1913-1927	15
α-helix	1948	1
β-strand	1949	1	190
α-helix	1950	1
β-strand	1951	1	189
α-helix	1954-1971	18
β-strand	1974	1	218
β-strand	1980	1	218
α-helix	1983-1987	5
α-helix	1992-1995	4
α-helix	2009-2012	4
β-strand	2017	1	219
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2306-2324	19
β-strand	2329-2336	8	220
α-helix	2337-2342	6
α-helix	2353-2362	10
β-strand	2368	1	221
β-strand	2375-2377	3	221
β-strand	2387-2392	6	221
α-helix	2393-2396	4
α-helix	2398-2401	4
β-strand	2410-2418	9	220
β-strand	2431-2435	5	221
β-strand	2448-2450	3	221
β-strand	2456-2457	2	220
β-strand	2468	1	219
α-helix	2469-2470	2
β-strand	2475-2476	2	220
β-strand	2481-2486	6	221
α-helix	2498-2503	6
β-strand	2508-2515	8	220

Chain H: 114 helices, 96 β-strands

Element	Residues	Length	Sheet
α-helix	19-24	6
α-helix	29-35	7
α-helix	43-69	27
α-helix	72-76	5
α-helix	86-95	10
α-helix	103	1
β-strand	104	1	222
α-helix	105	1
β-strand	111	1	223
α-helix	115-126	12
α-helix	127-129	3
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	224
α-helix	152-156	5
β-strand	160	1	225
α-helix	163-176	14
α-helix	182-191	10
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-252	8
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-296	7
β-strand	300	1	226
β-strand	306	1	226
β-strand	309	1	227
β-strand	312-319	8	227
β-strand	324-336	13	227
β-strand	342-349	8	228
β-strand	352-358	7	228
β-strand	367-371	5	227
β-strand	377-381	5	227
α-helix	384-385	2
β-strand	390-396	7	228
α-helix	399-403	5
β-strand	406-414	9	227
β-strand	418-432	15	227
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-487	16
α-helix	492-497	6
α-helix	501-504	4
α-helix	512-513	2
α-helix	514-519	6
β-strand	536-537	2	229
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-578	2	229
α-helix	582-597	16
α-helix	602-612	11
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	748-769	22
α-helix	773-781	9
α-helix	783-786	4
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	835-839	5
α-helix	843-855	13
α-helix	871-886	16
α-helix	891-899	9
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-924	13
α-helix	928-952	25
α-helix	964-971	8
β-strand	982	1	225
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1055-1063	9
α-helix	1071-1089	19
β-strand	1091-1098	8	230
β-strand	1107-1114	8	230
β-strand	1120-1127	8	230
β-strand	1141	1	230
β-strand	1145	1	230
β-strand	1159-1163	5	231
β-strand	1166-1179	14	231
β-strand	1191-1202	12	231
β-strand	1203	1	232
α-helix	1208	1
β-strand	1209	1	232
α-helix	1210-1212	3
β-strand	1213-1216	4	231
α-helix	1218-1223	6
β-strand	1234-1238	5	233
β-strand	1239	1	234
β-strand	1245-1249	5	233
β-strand	1265-1269	5	233
β-strand	1275-1278	4	233
α-helix	1279	1
α-helix	1280-1289	10
α-helix	1303-1305	3
β-strand	1306	1	234
β-strand	1310-1311	2	235
β-strand	1316	1	236
β-strand	1323	1	235
β-strand	1331	1	237
β-strand	1337	1	236
β-strand	1340-1345	6	238
β-strand	1348-1353	6	238
β-strand	1356-1358	3	239
β-strand	1360	1	237
α-helix	1363-1364	2
α-helix	1367-1378	12
β-strand	1384-1392	9	240
β-strand	1405-1410	6	240
β-strand	1420-1425	6	240
β-strand	1432-1437	6	240
β-strand	1444-1450	7	240
β-strand	1454-1458	5	240
α-helix	1466-1468	3
β-strand	1471-1475	5	240
β-strand	1480-1490	11	240
β-strand	1493	1	241
β-strand	1499-1504	6	235
β-strand	1507-1510	4	235
α-helix	1513-1516	4
α-helix	1521-1523	3
β-strand	1529-1531	3	239
β-strand	1535-1539	5	238
α-helix	1541	1
α-helix	1543-1544	2
β-strand	1545	1	235
β-strand	1548-1558	11	235
β-strand	1559	1	241
β-strand	1564-1576	13	235
β-strand	1585-1587	3	242
β-strand	1595-1598	4	242
β-strand	1601-1604	4	242
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
β-strand	1633-1634	2	243
β-strand	1641-1647	7	244
β-strand	1661-1666	6	245
β-strand	1674-1679	6	245
β-strand	1686-1692	7	244
β-strand	1705-1711	7	245
β-strand	1714	1	245
β-strand	1724-1728	5	245
β-strand	1732-1735	4	245
β-strand	1746-1750	5	244
β-strand	1756-1757	2	243
α-helix	1758-1759	2
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	246
β-strand	1806-1807	2	247
β-strand	1810-1811	2	247
β-strand	1816	1	246
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	224
α-helix	1907-1910	4
α-helix	1913-1927	15
α-helix	1943-1945	3
α-helix	1948	1
β-strand	1949	1	223
α-helix	1950	1
β-strand	1951	1	222
α-helix	1954-1971	18
α-helix	1983-1987	5
α-helix	1992-1994	3
α-helix	2009-2012	4
β-strand	2017	1	248
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2306-2324	19
β-strand	2329-2336	8	249
α-helix	2337-2342	6
α-helix	2353-2362	10
β-strand	2367-2368	2	250
β-strand	2375-2377	3	250
β-strand	2387-2392	6	250
α-helix	2393-2396	4
α-helix	2398-2400	3
β-strand	2410-2418	9	249
β-strand	2431-2435	5	250
β-strand	2448-2450	3	250
β-strand	2456-2457	2	249
β-strand	2468	1	248
α-helix	2469-2470	2
β-strand	2476	1	249
β-strand	2481-2486	6	250
α-helix	2498-2503	6
β-strand	2508-2515	8	249

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TcdA1	A, B, C, D, E, F, G, H, I, J	protein	2516	Photorhabdus luminescens	Q9RN43

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>4O9Y_1 TcdA1 (chains A, B, C, D, E, F, G, H, I, J)
MNESVKEIPDVLKSQCGFNCLTDISHSSFNEFRQQVSEHLSWSETHDLYHDAQQAQKDNR
LYEARILKRANPQLQNAVHLAILAPNAELIGYNNQFSGRASQYVAPGTVSSMFSPAAYLT
ELYREARNLHASDSVYYLDTRRPDLKSMALSQQNMDIELSTLSLSNELLLESIKTESKLE
NYTKVMEMLSTFRPSGATPYHDAYENVREVIQLQDPGLEQLNASPAIAGLMHQASLLGIN
ASISPELFNILTEEITEGNAEELYKKNFGNIEPASLAMPEYLKRYYNLSDEELSQFIGKA
SNFGQQEYSNNQLITPVVNSSDGTVKVYRITREYTTNAYQMDVELFPFGGENYRLDYKFK
NFYNASYLSIKLNDKRELVRTEGAPQVNIEYSANITLNTADISQPFEIGLTRVLPSGSWA
YAAAKFTVEEYNQYSFLLKLNKAIRLSRATELSPTILEGIVRSVNLQLDINTDVLGKVFL
TKYYMQRYAIHAETALILCNAPISQRSYDNQPSQFDRLFNTPLLNGQYFSTGDEEIDLNS
GSTGDWRKTILKRAFNIDDVSLFRLLKITDHDNKDGKIKNNLKNLSNLYIGKLLADIHQL
TIDELDLLLIAVGEGKTNLSAISDKQLATLIRKLNTITSWLHTQKWSVFQLFIMTSTSYN
KTLTPEIKNLLDTVYHGLQGFDKDKADLLHVMAPYIAATLQLSSENVAHSVLLWADKLQP
GDGAMTAEKFWDWLNTKYTPGSSEAVETQEHIVQYCQALAQLEMVYHSTGINENAFRLFV
TKPEMFGAATGAAPAHDALSLIMLTRFADWVNALGEKASSVLAAFEANSLTAEQLADAMN
LDANLLLQASIQAQNHQHLPPVTPENAFSCWTSINTILQWVNVAQQLNVAPQGVSALVGL
DYIQSMKETPTYAQWENAAGVLTAGLNSQQANTLHAFLDESRSAALSTYYIRQVAKAAAA
IKSRDDLYQYLLIDNQVSAAIKTTRIAEAIASIQLYVNRALENVEENANSGVISRQFFID
WDKYNKRYSTWAGVSQLVYYPENYIDPTMRIGQTKMMDALLQSVSQSQLNADTVEDAFMS
YLTSFEQVANLKVISAYHDNINNDQGLTYFIGLSETDAGEYYWRSVDHSKFNDGKFAANA
WSEWHKIDCPINPYKSTIRPVIYKSRLYLLWLEQKEITKQTGNSKDGYQTETDYRYELKL
AHIRYDGTWNTPITFDVNKKISELKLEKNRAPGLYCAGYQGEDTLLVMFYNQQDTLDSYK
NASMQGLYIFADMASKDMTPEQSNVYRDNSYQQFDTNNVRRVNNRYAEDYEIPSSVSSRK
DYGWGDYYLSMVYNGDIPTINYKAASSDLKIYISPKLRIIHNGYEGQKRNQCNLMNKYGK
LGDKFIVYTSLGVNPNNSSNKLMFYPVYQYSGNTSGLNQGRLLFHRDTTYPSKVEAWIPG
AKRSLTNQNAAIGDDYATDSLNKPDDLKQYIFMTDSKGTATDVSGPVEINTAISPAKVQI
IVKAGGKEQTFTADKDVSIQPSPSFDEMNYQFNALEIDGSGLNFINNSASIDVTFTAFAE
DGRKLGYESFSIPVTLKVSTDNALTLHHNENGAQYMQWQSYRTRLNTLFARQLVARATTG
IDTILSMETQNIQEPQLGKGFYATFVIPPYNLSTHGDERWFKLYIKHVVDNNSHIIYSGQ
LTDTNINITLFIPLDDVPLNQDYHAKVYMTFKKSPSDGTWWGPHFVRDDKGIVTINPKSI
LTHFESVNVLNNISSEPMDFSGANSLYFWELFYYTPMLVAQRLLHEQNFDEANRWLKYVW
SPSGYIVHGQIQNYQWNVRPLLEDTSWNSDPLDSVDPDAVAQHDPMHYKVSTFMRTLDLL
IARGDHAYRQLERDTLNEAKMWYMQALHLLGDKPYLPLSTTWSDPRLDRAADITTQNAHD
SAIVALRQNIPTPAPLSLRSANTLTDLFLPQINEVMMNYWQTLAQRVYNLRHNLSIDGQP
LYLPIYATPADPKALLSAAVATSQGGGKLPESFMSLWRFPHMLENARGMVSQLTQFGSTL
QNIIERQDAEALNALLQNQAAELILTNLSIQDKTIEELDAEKTVLEKSKAGAQSRFDSYG
KLYDENINAGENQAMTLRASAAGLTTAVQASRLAGAAADLVPNIFGFAGGGSRWGAIAEA
TGYVMEFSANVMNTEADKISQSETYRRRRQEWEIQRNNAEAELKQIDAQLKSLAVRREAA
VLQKTSLKTQQEQTQSQLAFLQRKFSNQALYNWLRGRLAAIYFQFYDLAVARCLMAEQAY
RWELNDDSARFIKPGAWQGTYAGLLAGETLMLSLAQMEDAHLKRDKRALEVERTVSLAEV
YAGLPKDNGPFSLAQEIDKLVSQGSGSAGSGNNNLAFGAGTDTKTSLQASVSFADLKIRE
DYPASLGKIRRIKQISVTLPALLGPYQDVQAILSYGDKAGLANGCEALAVSHGMNDSGQF
QLDFNDGKFLPFEGIAIDQGTLTLSFPNASMPEKGKQATMLKTLNDIILHIRYTIK

Primary citation

Mechanism of Tc toxin action revealed in molecular detail. Meusch, D., Gatsogiannis, C., Efremov, R.G. et al. Nature (2014) 508:61-65. DOI 10.1038/nature13015 · PubMed

Other PDB entries of the same protein (UniProt Q9RN43), best resolution first:

6RW6 2.75 Å, Cryo-EM structure of Photorhabdus luminescens TcdA1
6L7I 2.9 Å, Signal substraction of TcdB1-TccC2 and part of TcdA1
8CPZ 2.9 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K1179W mutant
6L7E 3.2 Å, Toxin Complex TcdA1-TcdB1-TccC2
8CQ0 3.2 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K567W K2008W mutant
6SUE 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore, Mutation TccC3-D651A
6SUF 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore
5LKH 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state (obtained by flexible fitting)
5LKI 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state
8CQ2 3.6 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, C16S, C20S, C870S, T1279C…
6H6F 3.72 Å, PTC3 holotoxin complex from Photorhabdus luminiscens - Mutant TcC-D651A
6H6E 3.95 Å, PTC3 holotoxin complex from Photorhabdus luminecens in prepore state (TcdA1, TcdB2, TccC3)

Browse structure collections

About this viewer

MolViewer shows 4O9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.