6H6F: TcdA1

Name: PDB 6H6F: PTC3 holotoxin complex from Photorhabdus luminiscens - Mutant TcC-D651A
Published: 2018-10-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

PTC3 holotoxin complex from Photorhabdus luminiscens - Mutant TcC-D651A. Determined by electron microscopy at 3.72 Å resolution. Released 3 Oct 2018.

Method: Electron microscopy
Resolution: 3.72 Å
Organism: Photorhabdus luminescens
Chains: 6
Atoms: 114,303
Mol. weight: 1689.78 kDa
Released: 3 Oct 2018

Explore 6H6F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H6F contains 737 α-helices and 745 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 131 helices, 114 β-strands

Element	Residues	Length	Sheet
α-helix	42-69	28
α-helix	72-75	4
α-helix	78-80	3
α-helix	87-95	9
α-helix	99-101	3
β-strand	104	1	1
β-strand	111	1	2
α-helix	115-126	12
α-helix	138-141	4
α-helix	143-147	5
α-helix	148	1
β-strand	149	1	3
α-helix	150	1
α-helix	152-156	5
β-strand	159-160	2	4
α-helix	161-176	16
α-helix	182-190	9
α-helix	202-214	13
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	253-255	3
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-300	2	5
β-strand	306-307	2	5
β-strand	309	1	6
β-strand	312-318	7	6
β-strand	325-336	12	6
β-strand	341-349	9	7
β-strand	352-359	8	7
β-strand	367-372	6	6
β-strand	376-382	7	6
α-helix	385-386	2
β-strand	387	1	7
β-strand	390-396	7	7
α-helix	399-402	4
β-strand	406-414	9	6
β-strand	418-432	15	6
α-helix	434-450	17
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	501-504	4
β-strand	508	1	8
β-strand	511	1	8
α-helix	514-520	7
β-strand	524	1	9
β-strand	527	1	9
α-helix	528-529	2
β-strand	535-537	3	10
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	10
α-helix	582-597	16
α-helix	602-612	11
α-helix	614-616	3
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	683-685	3
α-helix	689-700	12
α-helix	705-718	14
α-helix	727-736	10
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	788-789	2
α-helix	792-795	4
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-838	7
α-helix	843-855	13
α-helix	871-886	16
α-helix	891-898	8
α-helix	905-908	4
α-helix	912-923	12
α-helix	928-949	22
α-helix	950-954	5
α-helix	964-971	8
β-strand	982-983	2	4
α-helix	985-1001	17
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1063	9
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	11
β-strand	1107-1113	7	11
β-strand	1121-1127	7	11
α-helix	1128-1130	3
β-strand	1131-1132	2	12
β-strand	1135-1136	2	12
α-helix	1138-1140	3
β-strand	1141	1	11
α-helix	1142-1144	3
β-strand	1145-1146	2	11
α-helix	1154-1156	3
β-strand	1158-1163	6	13
β-strand	1166-1178	13	13
β-strand	1192-1202	11	13
β-strand	1203	1	14
β-strand	1209	1	14
β-strand	1213-1216	4	13
α-helix	1218-1222	5
α-helix	1231-1232	2
β-strand	1233-1239	7	15
α-helix	1241-1243	3
β-strand	1244-1250	7	15
α-helix	1256-1261	6
β-strand	1265-1269	5	15
β-strand	1275-1277	3	15
α-helix	1278-1279	2
α-helix	1280-1288	9
α-helix	1291-1293	3
β-strand	1296	1	16
β-strand	1299	1	16
β-strand	1300-1301	2	17
β-strand	1303	1	11
β-strand	1306	1	15
β-strand	1310-1311	2	18
β-strand	1316	1	19
β-strand	1321-1323	3	18
β-strand	1324	1	20
α-helix	1326-1328	3
β-strand	1331-1332	2	20
β-strand	1336	1	20
β-strand	1337	1	19
β-strand	1340-1345	6	21
β-strand	1348-1353	6	21
β-strand	1356-1360	5	20
α-helix	1367-1378	12
β-strand	1384-1392	9	22
β-strand	1404-1412	9	22
β-strand	1415-1426	12	22
β-strand	1433-1438	6	22
β-strand	1443-1448	6	22
α-helix	1450-1451	2
β-strand	1453-1458	6	22
α-helix	1464-1467	4
β-strand	1471-1474	4	22
β-strand	1480-1490	11	22
α-helix	1495-1497	3
β-strand	1498-1504	7	18
β-strand	1507-1512	6	18
α-helix	1513-1516	4
α-helix	1520-1522	3
β-strand	1527-1531	5	20
β-strand	1537-1538	2	21
β-strand	1545	1	18
β-strand	1548-1558	11	18
β-strand	1564-1576	13	18
α-helix	1582-1584	3
β-strand	1585-1589	5	17
β-strand	1593-1598	6	17
β-strand	1601-1604	4	17
α-helix	1609-1616	8
α-helix	1617-1619	3
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1633-1635	3	23
β-strand	1640-1647	8	24
α-helix	1648-1650	3
α-helix	1652-1655	4
β-strand	1660-1666	7	25
β-strand	1673-1680	8	25
β-strand	1686-1693	8	24
β-strand	1705-1711	7	25
β-strand	1714	1	25
β-strand	1721-1722	2	26
β-strand	1724-1727	4	25
β-strand	1733-1735	3	25
β-strand	1740	1	26
β-strand	1746-1750	5	24
β-strand	1755-1757	3	23
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	27
β-strand	1806-1807	2	28
β-strand	1810-1811	2	28
β-strand	1816	1	27
α-helix	1819-1823	5
α-helix	1837-1843	7
α-helix	1846-1869	24
α-helix	1873-1890	18
α-helix	1893-1894	2
β-strand	1906	1	3
α-helix	1907-1910	4
α-helix	1913-1927	15
α-helix	1944-1946	3
α-helix	1947-1948	2
β-strand	1949	1	2
α-helix	1950	1
β-strand	1951	1	1
α-helix	1954-1971	18
β-strand	1974	1	29
β-strand	1980	1	29
α-helix	1988-1992	5
α-helix	2000-2002	3
β-strand	2006	1	30
α-helix	2007-2012	6
β-strand	2017	1	31
α-helix	2019-2105	87
α-helix	2109-2122	14
α-helix	2125-2139	15
β-strand	2144-2146	3	32
β-strand	2148-2150	3	32
α-helix	2156-2243	88
α-helix	2248-2283	36
β-strand	2298	1	30
α-helix	2299-2301	3
α-helix	2306-2324	19
α-helix	2327-2328	2
β-strand	2329-2336	8	33
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	34
β-strand	2373-2377	5	34
β-strand	2387-2392	6	34
α-helix	2394-2396	3
α-helix	2399-2401	3
α-helix	2404-2406	3
β-strand	2410-2418	9	33
β-strand	2422-2423	2	35
β-strand	2431-2435	5	34
α-helix	2441-2442	2
β-strand	2447-2450	4	34
β-strand	2454	1	33
β-strand	2468	1	31
α-helix	2469-2470	2
β-strand	2475-2476	2	33
β-strand	2481-2486	6	34
α-helix	2497-2500	4
α-helix	2501-2503	3
β-strand	2508-2515	8	33

Chain B: 134 helices, 116 β-strands

Element	Residues	Length	Sheet
α-helix	42-69	28
α-helix	72-75	4
α-helix	78-80	3
α-helix	88-95	8
α-helix	99-101	3
β-strand	104	1	36
β-strand	111	1	37
α-helix	115-126	12
β-strand	130	1	38
α-helix	143-147	5
α-helix	148	1
β-strand	149	1	39
α-helix	150	1
α-helix	152-156	5
β-strand	159-160	2	40
α-helix	161-176	16
α-helix	182-190	9
α-helix	202-214	13
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	253-255	3
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-301	3	41
β-strand	305-307	3	41
β-strand	309	1	42
β-strand	312-318	7	42
β-strand	325-336	12	42
β-strand	341-349	9	43
β-strand	352-359	8	43
β-strand	367-372	6	42
β-strand	376-382	7	42
α-helix	384-386	3
β-strand	387	1	43
β-strand	390-396	7	43
α-helix	399-402	4
β-strand	406-414	9	42
β-strand	418-432	15	42
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	502-504	3
β-strand	508	1	44
β-strand	511	1	44
α-helix	514-520	7
β-strand	535-537	3	45
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	45
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	689-699	11
α-helix	705-718	14
α-helix	727-736	10
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	788-789	2
α-helix	792-795	4
α-helix	798-813	16
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-838	7
α-helix	843-855	13
α-helix	864-866	3
α-helix	871-887	17
α-helix	891-898	8
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-923	12
α-helix	928-949	22
α-helix	950-954	5
α-helix	964-971	8
β-strand	982-983	2	40
α-helix	985-1001	17
β-strand	1008	1	38
α-helix	1012-1014	3
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1036	9
α-helix	1041-1043	3
α-helix	1055-1063	9
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	46
β-strand	1107-1113	7	46
β-strand	1121-1127	7	46
α-helix	1128-1130	3
β-strand	1131-1132	2	47
β-strand	1135-1136	2	47
α-helix	1138-1140	3
β-strand	1141	1	46
α-helix	1142-1144	3
β-strand	1145-1146	2	46
α-helix	1154-1156	3
β-strand	1158-1163	6	48
β-strand	1166-1178	13	48
β-strand	1192-1202	11	48
β-strand	1203	1	49
β-strand	1209	1	49
α-helix	1211-1212	2
β-strand	1213-1216	4	48
α-helix	1218-1222	5
α-helix	1231-1232	2
β-strand	1233-1239	7	50
α-helix	1241-1243	3
β-strand	1244-1250	7	50
α-helix	1256-1261	6
β-strand	1265-1269	5	50
β-strand	1275-1277	3	50
α-helix	1278-1279	2
α-helix	1280-1288	9
α-helix	1291-1293	3
β-strand	1296	1	51
β-strand	1299	1	51
β-strand	1300-1301	2	52
β-strand	1303	1	46
β-strand	1306	1	50
β-strand	1310-1311	2	53
β-strand	1316	1	54
β-strand	1321-1323	3	53
β-strand	1324	1	55
α-helix	1326-1328	3
β-strand	1331-1332	2	55
β-strand	1336	1	55
β-strand	1337	1	54
β-strand	1340-1345	6	56
β-strand	1348-1353	6	56
β-strand	1356-1360	5	55
α-helix	1367-1377	11
β-strand	1384-1387	4	57
β-strand	1390-1393	4	58
β-strand	1407-1412	6	57
β-strand	1415-1425	11	57
β-strand	1432-1438	7	58
β-strand	1443-1450	8	58
α-helix	1451	1
β-strand	1454-1458	5	57
α-helix	1464-1467	4
β-strand	1471-1474	4	58
β-strand	1480-1484	5	58
β-strand	1487-1490	4	57
α-helix	1495-1497	3
β-strand	1498-1504	7	53
β-strand	1507-1512	6	53
α-helix	1513-1516	4
α-helix	1520-1522	3
β-strand	1528-1531	4	55
α-helix	1532-1534	3
β-strand	1535-1538	4	56
β-strand	1545	1	53
β-strand	1548-1558	11	53
β-strand	1564-1576	13	53
α-helix	1582-1584	3
β-strand	1585-1589	5	52
β-strand	1593-1598	6	52
β-strand	1601-1604	4	52
α-helix	1609-1616	8
α-helix	1617-1619	3
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1633-1635	3	59
β-strand	1640-1647	8	60
α-helix	1648-1650	3
α-helix	1652-1655	4
β-strand	1660-1666	7	61
β-strand	1673-1680	8	61
β-strand	1686-1693	8	60
β-strand	1705-1711	7	61
β-strand	1714	1	61
β-strand	1721	1	62
β-strand	1724-1727	4	61
β-strand	1733-1735	3	61
β-strand	1740	1	62
β-strand	1746-1750	5	60
β-strand	1755-1757	3	59
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1796	8
β-strand	1800	1	63
β-strand	1806-1807	2	64
β-strand	1810-1811	2	64
β-strand	1816	1	63
α-helix	1819-1823	5
α-helix	1837-1843	7
α-helix	1846-1870	25
α-helix	1873-1890	18
α-helix	1893-1894	2
β-strand	1906	1	39
α-helix	1907-1910	4
α-helix	1913-1927	15
α-helix	1944-1946	3
α-helix	1947-1948	2
β-strand	1949	1	37
α-helix	1950	1
β-strand	1951	1	36
α-helix	1954-1971	18
β-strand	1974	1	65
β-strand	1980	1	65
α-helix	1983-1986	4
α-helix	1988-1992	5
α-helix	2000-2002	3
β-strand	2006	1	66
α-helix	2007-2012	6
β-strand	2017	1	67
α-helix	2019-2105	87
α-helix	2109-2122	14
α-helix	2125-2139	15
β-strand	2144-2146	3	32
β-strand	2148-2150	3	32
α-helix	2156-2243	88
α-helix	2248-2283	36
β-strand	2298	1	66
α-helix	2299-2301	3
α-helix	2306-2324	19
α-helix	2327-2328	2
β-strand	2329-2336	8	68
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	69
β-strand	2373-2377	5	69
α-helix	2381-2383	3
β-strand	2387-2392	6	69
α-helix	2393-2396	4
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	68
β-strand	2422-2423	2	70
β-strand	2431-2435	5	69
α-helix	2442	1
β-strand	2447-2450	4	69
β-strand	2456	1	68
β-strand	2468	1	67
α-helix	2469-2470	2
β-strand	2476	1	68
β-strand	2481-2486	6	69
α-helix	2491-2493	3
α-helix	2498-2503	6
β-strand	2508-2515	8	68

Chain C: 142 helices, 121 β-strands

Element	Residues	Length	Sheet
α-helix	42-69	28
α-helix	72-75	4
α-helix	78-80	3
α-helix	86-96	11
β-strand	104	1	71
β-strand	111	1	72
α-helix	115-126	12
β-strand	130	1	73
α-helix	138-141	4
α-helix	144-147	4
α-helix	148	1
β-strand	149	1	74
α-helix	150	1
α-helix	152-156	5
β-strand	159-160	2	75
α-helix	161-177	17
α-helix	182-190	9
α-helix	202-214	13
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	253-255	3
α-helix	257-259	3
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-301	3	76
β-strand	305-307	3	76
β-strand	309	1	77
β-strand	312-318	7	77
α-helix	319	1
β-strand	325-336	12	77
α-helix	338-340	3
β-strand	341-349	9	78
β-strand	352-359	8	78
β-strand	367-372	6	77
β-strand	376-382	7	77
α-helix	384-386	3
β-strand	387	1	78
β-strand	390-396	7	78
α-helix	399-402	4
β-strand	406-413	8	77
β-strand	419-432	14	77
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	501-504	4
β-strand	508	1	79
β-strand	511	1	79
α-helix	514-519	6
β-strand	524	1	80
β-strand	527	1	80
α-helix	528-529	2
β-strand	535-537	3	81
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	81
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	683-685	3
α-helix	689-699	11
α-helix	705-718	14
α-helix	727-734	8
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	788-789	2
α-helix	792-795	4
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-838	7
α-helix	843-855	13
α-helix	864-866	3
α-helix	871-887	17
α-helix	891-898	8
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-923	12
α-helix	928-953	26
α-helix	964-971	8
β-strand	982-983	2	75
α-helix	985-1001	17
β-strand	1008	1	73
α-helix	1012-1014	3
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1062	8
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	82
β-strand	1107-1113	7	82
β-strand	1121-1127	7	82
α-helix	1128-1130	3
β-strand	1131-1132	2	83
β-strand	1135-1136	2	83
α-helix	1138-1140	3
β-strand	1141	1	82
α-helix	1142-1144	3
β-strand	1145-1146	2	82
α-helix	1154-1156	3
β-strand	1158-1163	6	84
β-strand	1166-1178	13	84
β-strand	1192-1202	11	84
β-strand	1203	1	85
β-strand	1209	1	85
α-helix	1211-1212	2
β-strand	1213-1216	4	84
α-helix	1218-1222	5
α-helix	1231-1232	2
β-strand	1233-1239	7	86
α-helix	1241-1243	3
β-strand	1244-1250	7	86
α-helix	1256-1259	4
α-helix	1262-1264	3
β-strand	1265-1269	5	86
β-strand	1275-1277	3	86
α-helix	1278-1279	2
α-helix	1280-1288	9
α-helix	1291-1293	3
β-strand	1296	1	87
β-strand	1299	1	87
β-strand	1300-1301	2	88
β-strand	1303-1304	2	82
β-strand	1306	1	86
β-strand	1311	1	89
β-strand	1316	1	90
β-strand	1321-1323	3	89
β-strand	1324	1	91
α-helix	1326-1328	3
β-strand	1331-1332	2	91
β-strand	1336	1	91
β-strand	1337	1	90
β-strand	1340-1344	5	92
β-strand	1349-1353	5	92
β-strand	1356-1360	5	91
α-helix	1367-1378	12
β-strand	1384-1387	4	93
β-strand	1390-1393	4	94
β-strand	1405-1412	8	93
β-strand	1415-1426	12	93
β-strand	1432-1438	7	94
β-strand	1443-1450	8	94
α-helix	1451	1
β-strand	1453-1458	6	93
α-helix	1464-1466	3
β-strand	1471-1474	4	94
β-strand	1481-1484	4	94
β-strand	1487-1490	4	93
α-helix	1495-1497	3
β-strand	1498-1504	7	89
β-strand	1507-1512	6	89
α-helix	1513-1516	4
β-strand	1517	1	95
α-helix	1520-1522	3
β-strand	1527-1531	5	91
β-strand	1532	1	95
α-helix	1533-1534	2
β-strand	1535-1538	4	92
β-strand	1545	1	89
β-strand	1548-1558	11	89
β-strand	1564-1575	12	89
α-helix	1576-1577	2
α-helix	1582-1584	3
β-strand	1585-1589	5	88
β-strand	1593-1598	6	88
β-strand	1601-1604	4	88
α-helix	1609-1616	8
α-helix	1617-1619	3
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1633-1635	3	96
β-strand	1640-1647	8	97
α-helix	1648-1650	3
α-helix	1652-1655	4
β-strand	1660-1666	7	98
β-strand	1668	1	99
β-strand	1670	1	99
β-strand	1674-1680	7	98
β-strand	1686-1693	8	97
β-strand	1700	1	100
β-strand	1703	1	100
β-strand	1705-1711	7	98
β-strand	1714	1	98
β-strand	1721-1722	2	101
β-strand	1724-1727	4	98
β-strand	1733-1735	3	98
β-strand	1740	1	101
β-strand	1746-1750	5	97
β-strand	1755-1757	3	96
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	102
β-strand	1806-1807	2	103
β-strand	1810-1811	2	103
α-helix	1812	1
β-strand	1816	1	102
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	74
α-helix	1907-1910	4
α-helix	1913-1928	16
α-helix	1944-1946	3
α-helix	1948	1
β-strand	1949	1	72
α-helix	1950	1
β-strand	1951	1	71
α-helix	1954-1971	18
β-strand	1974	1	104
β-strand	1980	1	104
α-helix	1984-1986	3
α-helix	1988-1992	5
α-helix	2000-2002	3
α-helix	2009-2012	4
β-strand	2017	1	105
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
β-strand	2144-2146	3	32
β-strand	2148-2150	3	32
α-helix	2156-2243	88
α-helix	2248-2284	37
α-helix	2299-2301	3
α-helix	2306-2324	19
α-helix	2327-2328	2
β-strand	2329-2336	8	106
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	107
β-strand	2373-2377	5	107
β-strand	2387-2392	6	107
α-helix	2394-2396	3
α-helix	2399-2401	3
α-helix	2404-2406	3
β-strand	2410-2418	9	106
β-strand	2431-2435	5	107
α-helix	2438-2440	3
α-helix	2442	1
β-strand	2447-2450	4	107
β-strand	2454-2456	3	106
β-strand	2468	1	105
α-helix	2469-2470	2
β-strand	2476	1	106
β-strand	2481-2486	6	107
α-helix	2491-2493	3
α-helix	2501-2503	3
β-strand	2508-2515	8	106

Chain D: 132 helices, 112 β-strands

Element	Residues	Length	Sheet
α-helix	42-69	28
α-helix	72-77	6
α-helix	86-95	10
α-helix	99-101	3
β-strand	104	1	108
β-strand	111	1	109
α-helix	115-126	12
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	110
α-helix	152-156	5
β-strand	159-160	2	111
α-helix	161-176	16
α-helix	182-190	9
α-helix	202-214	13
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	260-268	9
α-helix	273-277	5
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-301	3	112
β-strand	305-307	3	112
β-strand	309	1	113
β-strand	312-319	8	113
β-strand	324-336	13	113
α-helix	338-340	3
β-strand	341-349	9	114
β-strand	352-359	8	114
β-strand	367-372	6	113
β-strand	376-382	7	113
α-helix	384-386	3
β-strand	390-396	7	114
α-helix	399-402	4
β-strand	406-414	9	113
β-strand	418-431	14	113
α-helix	435-450	16
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	502-504	3
β-strand	508	1	115
β-strand	511	1	115
α-helix	512-513	2
α-helix	514-519	6
β-strand	524	1	116
β-strand	527	1	116
α-helix	528-529	2
β-strand	535-537	3	117
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	117
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	689-700	12
α-helix	705-718	14
α-helix	727-736	10
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	788-789	2
α-helix	792-795	4
α-helix	798-813	16
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-838	7
α-helix	843-855	13
α-helix	864-866	3
α-helix	871-886	16
α-helix	891-898	8
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-923	12
α-helix	928-949	22
α-helix	950-954	5
α-helix	964-971	8
β-strand	982-983	2	111
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1063	9
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	118
β-strand	1107-1113	7	118
β-strand	1121-1127	7	118
α-helix	1128-1130	3
β-strand	1131	1	119
β-strand	1136	1	119
α-helix	1138-1140	3
β-strand	1141	1	118
α-helix	1142-1144	3
β-strand	1145-1146	2	118
α-helix	1154-1156	3
β-strand	1158-1163	6	120
β-strand	1166-1178	13	120
β-strand	1192-1202	11	120
β-strand	1203	1	121
β-strand	1209	1	121
β-strand	1213-1216	4	120
α-helix	1218-1223	6
β-strand	1233-1239	7	122
α-helix	1241-1243	3
β-strand	1244-1250	7	122
α-helix	1256-1259	4
β-strand	1265-1269	5	122
β-strand	1275-1277	3	122
α-helix	1278-1279	2
α-helix	1280-1288	9
α-helix	1291-1293	3
β-strand	1300-1301	2	123
β-strand	1303	1	118
β-strand	1306	1	122
β-strand	1310-1311	2	124
β-strand	1316	1	125
β-strand	1321-1323	3	124
β-strand	1324	1	126
α-helix	1326-1328	3
β-strand	1331-1332	2	126
β-strand	1336	1	126
β-strand	1337	1	125
β-strand	1340-1345	6	127
β-strand	1348-1353	6	127
β-strand	1356-1360	5	126
α-helix	1367-1377	11
β-strand	1384-1393	10	128
β-strand	1405-1412	8	128
β-strand	1415-1425	11	128
β-strand	1433-1438	6	128
β-strand	1443-1448	6	128
α-helix	1450-1451	2
β-strand	1454-1458	5	128
α-helix	1464-1467	4
β-strand	1471-1474	4	128
β-strand	1480-1490	11	128
α-helix	1495-1497	3
β-strand	1498-1504	7	124
β-strand	1507-1512	6	124
α-helix	1513-1516	4
β-strand	1517	1	129
α-helix	1520-1522	3
β-strand	1527-1531	5	126
β-strand	1532	1	129
α-helix	1533-1534	2
β-strand	1535-1538	4	127
β-strand	1545	1	124
β-strand	1548-1558	11	124
β-strand	1564-1576	13	124
α-helix	1582-1584	3
β-strand	1585-1588	4	123
β-strand	1594-1598	5	123
β-strand	1601-1604	4	123
α-helix	1609-1616	8
α-helix	1617-1619	3
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1633-1635	3	130
β-strand	1640-1647	8	131
α-helix	1648-1650	3
α-helix	1652-1655	4
β-strand	1660-1666	7	132
β-strand	1674-1680	7	132
β-strand	1686-1693	8	131
β-strand	1705-1711	7	132
β-strand	1714	1	132
β-strand	1721	1	133
β-strand	1724-1727	4	132
β-strand	1733-1735	3	132
β-strand	1740	1	133
β-strand	1746-1750	5	131
β-strand	1755-1757	3	130
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	134
β-strand	1806-1807	2	135
β-strand	1810-1811	2	135
β-strand	1816	1	134
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1870	25
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	110
α-helix	1907-1910	4
α-helix	1913-1927	15
α-helix	1944-1946	3
α-helix	1948	1
β-strand	1949	1	109
α-helix	1950	1
β-strand	1951	1	108
α-helix	1954-1971	18
β-strand	1974	1	136
β-strand	1980	1	136
α-helix	1983-1992	10
α-helix	2000-2002	3
β-strand	2006	1	137
α-helix	2009-2012	4
β-strand	2017	1	138
α-helix	2019-2105	87
α-helix	2109-2122	14
α-helix	2125-2138	14
β-strand	2144-2146	3	32
β-strand	2148-2150	3	32
α-helix	2156-2243	88
α-helix	2248-2284	37
β-strand	2298	1	137
α-helix	2299-2301	3
α-helix	2306-2323	18
α-helix	2328	1
β-strand	2329-2336	8	139
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	140
β-strand	2373-2377	5	140
β-strand	2387-2392	6	140
α-helix	2393-2396	4
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	139
β-strand	2431-2435	5	140
α-helix	2438-2440	3
β-strand	2447-2450	4	140
β-strand	2456	1	139
β-strand	2468	1	138
α-helix	2469-2470	2
β-strand	2476	1	139
β-strand	2481-2486	6	140
α-helix	2491-2493	3
α-helix	2497-2500	4
α-helix	2501-2503	3
β-strand	2508-2515	8	139

Chain E: 131 helices, 110 β-strands

Element	Residues	Length	Sheet
α-helix	42-69	28
α-helix	72-77	6
α-helix	82-84	3
α-helix	86-95	10
α-helix	99-101	3
β-strand	104	1	141
β-strand	111	1	142
α-helix	115-126	12
β-strand	130	1	143
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	144
α-helix	152-156	5
β-strand	159-160	2	145
α-helix	161-176	16
α-helix	182-190	9
α-helix	202-214	13
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	253-255	3
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-301	3	146
β-strand	305-307	3	146
β-strand	309	1	147
β-strand	312-318	7	147
β-strand	325-336	12	147
α-helix	338-340	3
β-strand	341-349	9	148
β-strand	352-359	8	148
β-strand	367-372	6	147
β-strand	376-382	7	147
α-helix	384-386	3
β-strand	390-396	7	148
α-helix	399-402	4
β-strand	406-413	8	147
β-strand	419-432	14	147
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	502-504	3
β-strand	508	1	149
β-strand	511	1	149
α-helix	514-519	6
β-strand	524	1	150
β-strand	527	1	150
α-helix	528-529	2
β-strand	535-537	3	151
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	151
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	683-685	3
α-helix	689-700	12
α-helix	705-718	14
α-helix	727-736	10
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	789-791	3
α-helix	792-795	4
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-838	7
α-helix	843-855	13
α-helix	871-887	17
α-helix	891-898	8
α-helix	905-908	4
α-helix	912-923	12
α-helix	928-953	26
α-helix	964-971	8
β-strand	982-983	2	145
α-helix	985-1001	17
β-strand	1008	1	143
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1062	8
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	152
β-strand	1107-1113	7	152
α-helix	1119-1120	2
β-strand	1121-1127	7	152
α-helix	1128-1130	3
β-strand	1131-1132	2	153
β-strand	1135-1136	2	153
α-helix	1138-1140	3
β-strand	1141	1	152
α-helix	1142-1144	3
β-strand	1145-1147	3	152
α-helix	1154-1156	3
β-strand	1158-1163	6	154
β-strand	1166-1178	13	154
β-strand	1192-1202	11	154
β-strand	1203	1	155
β-strand	1209	1	155
α-helix	1211-1212	2
β-strand	1213-1216	4	154
α-helix	1218-1223	6
α-helix	1231-1232	2
β-strand	1233-1239	7	156
α-helix	1241-1243	3
β-strand	1244-1250	7	156
α-helix	1256-1259	4
β-strand	1265-1269	5	156
β-strand	1275-1277	3	156
α-helix	1278-1279	2
α-helix	1280-1288	9
α-helix	1291-1293	3
β-strand	1300-1302	3	157
β-strand	1303	1	152
β-strand	1306	1	156
β-strand	1310-1311	2	158
β-strand	1316	1	159
β-strand	1321-1323	3	158
β-strand	1324	1	160
α-helix	1326-1328	3
β-strand	1331-1332	2	160
β-strand	1336	1	160
β-strand	1337	1	159
β-strand	1340-1345	6	161
β-strand	1348-1353	6	161
β-strand	1356-1360	5	160
α-helix	1367-1377	11
β-strand	1384-1393	10	162
β-strand	1404-1412	9	162
β-strand	1415-1426	12	162
β-strand	1434-1438	5	162
β-strand	1443-1447	5	162
α-helix	1450-1451	2
β-strand	1453-1458	6	162
α-helix	1464-1467	4
β-strand	1471-1474	4	162
β-strand	1481-1490	10	162
α-helix	1495-1497	3
β-strand	1498-1504	7	158
β-strand	1507-1512	6	158
α-helix	1513-1516	4
α-helix	1520-1522	3
β-strand	1527-1531	5	160
α-helix	1534	1
β-strand	1535-1538	4	161
β-strand	1545	1	158
β-strand	1548-1558	11	158
β-strand	1564-1576	13	158
α-helix	1582-1583	2
β-strand	1584-1588	5	157
β-strand	1594-1598	5	157
β-strand	1601-1604	4	157
α-helix	1609-1616	8
α-helix	1617-1619	3
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1633-1635	3	163
β-strand	1640-1647	8	164
α-helix	1648-1650	3
α-helix	1652-1655	4
β-strand	1660-1668	9	165
β-strand	1670-1680	11	165
β-strand	1686-1693	8	164
β-strand	1705-1711	7	165
β-strand	1714	1	165
β-strand	1721	1	166
β-strand	1724-1727	4	165
β-strand	1733-1735	3	165
β-strand	1740	1	166
β-strand	1746-1750	5	164
β-strand	1755-1757	3	163
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	167
β-strand	1806-1807	2	168
β-strand	1810-1811	2	168
β-strand	1816	1	167
α-helix	1819-1823	5
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1869	24
α-helix	1873-1890	18
β-strand	1906	1	144
α-helix	1907-1910	4
α-helix	1913-1927	15
α-helix	1944-1946	3
α-helix	1948	1
β-strand	1949	1	142
α-helix	1950	1
β-strand	1951	1	141
α-helix	1954-1971	18
β-strand	1974	1	169
β-strand	1980	1	169
α-helix	1988-1992	5
α-helix	2000-2002	3
α-helix	2007-2012	6
β-strand	2017	1	170
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2139	15
β-strand	2144-2146	3	32
β-strand	2148-2150	3	32
α-helix	2156-2243	88
α-helix	2248-2284	37
α-helix	2299-2301	3
α-helix	2306-2323	18
α-helix	2328	1
β-strand	2329-2336	8	171
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2361	9
β-strand	2367-2370	4	172
β-strand	2373-2377	5	172
β-strand	2387-2392	6	172
α-helix	2394-2396	3
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	171
β-strand	2431-2435	5	172
α-helix	2441-2442	2
β-strand	2447-2450	4	172
β-strand	2456	1	171
β-strand	2468	1	170
α-helix	2469-2470	2
β-strand	2476	1	171
β-strand	2481-2486	6	172
α-helix	2491-2493	3
α-helix	2500-2503	4
β-strand	2508-2515	8	171

Chain F: 67 helices, 172 β-strands

Element	Residues	Length	Sheet
β-strand	38-42	5	173
β-strand	56-60	5	173
β-strand	65-66	2	174
β-strand	69-70	2	174
β-strand	72-73	2	173
β-strand	78-81	4	175
α-helix	88-89	2
β-strand	96-98	3	175
β-strand	102-103	2	175
β-strand	104-106	3	176
β-strand	111-116	6	176
β-strand	119-132	14	176
β-strand	134-135	2	176
β-strand	140-146	7	176
β-strand	149	1	177
β-strand	151	1	177
β-strand	154-159	6	176
β-strand	161	1	176
β-strand	163-167	5	176
β-strand	174-177	4	175
β-strand	180-188	9	175
β-strand	189-193	5	176
β-strand	199-206	8	176
α-helix	214-218	5
β-strand	227-236	10	176
α-helix	249-252	4
α-helix	253-255	3
β-strand	256-263	8	176
α-helix	274-276	3
α-helix	283-286	4
β-strand	290-292	3	178
β-strand	299-301	3	178
β-strand	307-312	6	176
α-helix	314-317	4
β-strand	328-338	11	176
β-strand	345-355	11	176
β-strand	359-362	4	176
α-helix	364-365	2
β-strand	366-370	5	176
α-helix	375-378	4
β-strand	380-384	5	179
β-strand	396-399	4	180
β-strand	408-413	6	180
β-strand	416-420	5	180
β-strand	422-424	3	181
β-strand	433-435	3	181
α-helix	436-438	3
β-strand	439-440	2	180
β-strand	444-445	2	70
β-strand	451-454	4	182
β-strand	463-466	4	182
β-strand	473-476	4	182
β-strand	477	1	183
α-helix	478	1
α-helix	482	1
β-strand	483	1	183
α-helix	484-486	3
β-strand	487	1	182
β-strand	492-493	2	35
α-helix	494-497	4
β-strand	502-504	3	184
β-strand	513-517	5	184
β-strand	521-525	5	184
β-strand	527	1	185
β-strand	532	1	185
α-helix	533-535	3
β-strand	536-539	4	184
α-helix	540	1
β-strand	556-560	5	186
β-strand	569-573	5	186
β-strand	578-581	4	186
β-strand	583-585	3	187
β-strand	588-589	2	187
β-strand	593-595	3	186
α-helix	607-609	3
β-strand	610-613	4	188
α-helix	621	1
β-strand	622-627	6	188
β-strand	630-636	7	188
β-strand	642-649	8	188
α-helix	650-651	2
β-strand	661-665	5	179
β-strand	674-679	6	179
β-strand	685-690	6	179
β-strand	699-703	5	176
β-strand	708-716	9	176
α-helix	717-731	15
β-strand	738	1	176
β-strand	744-753	10	176
β-strand	759-771	13	176
β-strand	778-791	14	176
α-helix	792-793	2
α-helix	800-803	4
β-strand	804-810	7	176
α-helix	815-820	6
α-helix	821-823	3
α-helix	826-827	2
α-helix	832-833	2
β-strand	838-843	6	176
β-strand	846-850	5	176
α-helix	855-863	9
β-strand	869-876	8	176
β-strand	888-898	11	176
β-strand	909-920	12	176
β-strand	929-938	10	176
β-strand	944-951	8	176
α-helix	952-958	7
α-helix	964-966	3
α-helix	969-973	5
α-helix	978-980	3
β-strand	983-996	14	176
β-strand	1001-1016	16	176
α-helix	1018-1020	3
α-helix	1022	1
α-helix	1028-1032	5
β-strand	1045-1054	10	176
α-helix	1062-1063	2
β-strand	1072-1080	9	176
α-helix	1082-1085	4
α-helix	1086-1088	3
α-helix	1094-1103	10
β-strand	1106-1109	4	176
α-helix	1118-1120	3
β-strand	1121-1131	11	176
α-helix	1134-1136	3
β-strand	1140-1146	7	176
α-helix	1150-1151	2
β-strand	1152-1156	5	176
β-strand	1163-1167	5	176
β-strand	1173	1	176
β-strand	1175-1179	5	189
β-strand	1184-1189	6	189
β-strand	1195-1200	6	189
β-strand	1206-1214	9	189
β-strand	1219-1221	3	189
α-helix	1225-1227	3
α-helix	1236-1240	5
β-strand	1249	1	189
β-strand	1251-1255	5	190
β-strand	1262	1	191
α-helix	1265-1267	3
α-helix	1268-1272	5
α-helix	1273-1281	9
β-strand	1285	1	192
β-strand	1290	1	191
β-strand	1291	1	192
α-helix	1292	1
α-helix	1294-1301	8
α-helix	1307-1314	8
β-strand	1322-1327	6	190
β-strand	1331	1	193
β-strand	1334	1	193
α-helix	1338-1339	2
β-strand	1340-1346	7	190
β-strand	1352-1358	7	190
β-strand	1362-1368	7	190
β-strand	1372-1380	9	190
β-strand	1384-1387	4	190
β-strand	1390-1392	3	194
β-strand	1398-1402	5	194
β-strand	1405-1407	3	190
α-helix	1412-1414	3
α-helix	1415-1420	6
β-strand	1426-1431	6	194
β-strand	1437-1441	5	194
β-strand	1447-1452	6	194
β-strand	1456-1460	5	194
α-helix	1462-1469	8
α-helix	1485-1488	4
β-strand	1493-1497	5	194
β-strand	1503-1510	8	194
β-strand	1519-1527	9	194
β-strand	1533-1537	5	194
α-helix	1539-1547	9
α-helix	1551-1553	3
β-strand	1555-1559	5	194
β-strand	1565-1570	6	194
β-strand	1574-1580	7	194
β-strand	1586-1590	5	194
β-strand	1596-1601	6	194
β-strand	1610-1616	7	194
β-strand	1624-1631	8	194
α-helix	1636-1640	5
β-strand	1647-1651	5	194
β-strand	1655-1662	8	194
β-strand	1668-1676	9	194
α-helix	1689-1695	7
β-strand	1696-1707	12	194
β-strand	1713-1717	5	194
β-strand	1723-1728	6	194
β-strand	1734-1740	7	194
β-strand	1747-1755	9	194
β-strand	1761-1766	6	194
β-strand	1770-1777	8	194
β-strand	1782-1790	9	194
α-helix	1791-1793	3
β-strand	1795-1804	10	194
β-strand	1810-1815	6	194
β-strand	1818	1	195
β-strand	1823	1	196
β-strand	1828	1	195
α-helix	1829-1831	3
β-strand	1832-1833	2	194
β-strand	1834-1836	3	197
β-strand	1842-1850	9	197
α-helix	1860-1863	4
β-strand	1864	1	198
α-helix	1866-1868	3
β-strand	1870	1	196
β-strand	1872-1881	10	197
β-strand	1887-1893	7	197
β-strand	1901-1904	4	197
β-strand	1905-1907	3	199
β-strand	1914-1916	3	199
α-helix	1926-1929	4
β-strand	1930	1	200
β-strand	1936	1	200
β-strand	1938-1940	3	201
β-strand	1943-1944	2	201
β-strand	1945-1947	3	198
β-strand	1953-1959	7	198
α-helix	1965-1967	3
β-strand	1968-1974	7	198
β-strand	1980-1989	10	198
β-strand	1992-2001	10	198
β-strand	2004-2011	8	198
β-strand	2014-2024	11	198
β-strand	2032-2039	8	198
β-strand	2049-2055	7	198
β-strand	2061-2065	5	198
β-strand	2071-2078	8	198
β-strand	2082-2088	7	198
α-helix	2091-2094	4
β-strand	2099	1	202
α-helix	2101-2103	3
β-strand	2105	1	202
β-strand	2112-2114	3	203
β-strand	2117-2119	3	203
α-helix	2144-2146	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TcdA1	A, B, C, D, E	protein	2516	Photorhabdus luminescens	Q9RN43
TcdB2,TccC3,TccC3	F	protein	2434	Photorhabdus luminescens	Q8GF97 (AlphaFold model), Q8GF99

Sequence of entity 1 (A, B, C, D, E), FASTA

>6H6F_1 TcdA1 (chains A, B, C, D, E)
MNESVKEIPDVLKSQCGFNCLTDISHSSFNEFRQQVSEHLSWSETHDLYHDAQQAQKDNR
LYEARILKRANPQLQNAVHLAILAPNAELIGYNNQFSGRASQYVAPGTVSSMFSPAAYLT
ELYREARNLHASDSVYYLDTRRPDLKSMALSQQNMDIELSTLSLSNELLLESIKTESKLE
NYTKVMEMLSTFRPSGATPYHDAYENVREVIQLQDPGLEQLNASPAIAGLMHQASLLGIN
ASISPELFNILTEEITEGNAEELYKKNFGNIEPASLAMPEYLKRYYNLSDEELSQFIGKA
SNFGQQEYSNNQLITPVVNSSDGTVKVYRITREYTTNAYQMDVELFPFGGENYRLDYKFK
NFYNASYLSIKLNDKRELVRTEGAPQVNIEYSANITLNTADISQPFEIGLTRVLPSGSWA
YAAAKFTVEEYNQYSFLLKLNKAIRLSRATELSPTILEGIVRSVNLQLDINTDVLGKVFL
TKYYMQRYAIHAETALILCNAPISQRSYDNQPSQFDRLFNTPLLNGQYFSTGDEEIDLNS
GSTGDWRKTILKRAFNIDDVSLFRLLKITDHDNKDGKIKNNLKNLSNLYIGKLLADIHQL
TIDELDLLLIAVGEGKTNLSAISDKQLATLIRKLNTITSWLHTQKWSVFQLFIMTSTSYN
KTLTPEIKNLLDTVYHGLQGFDKDKADLLHVMAPYIAATLQLSSENVAHSVLLWADKLQP
GDGAMTAEKFWDWLNTKYTPGSSEAVETQEHIVQYCQALAQLEMVYHSTGINENAFRLFV
TKPEMFGAATGAAPAHDALSLIMLTRFADWVNALGEKASSVLAAFEANSLTAEQLADAMN
LDANLLLQASIQAQNHQHLPPVTPENAFSCWTSINTILQWVNVAQQLNVAPQGVSALVGL
DYIQSMKETPTYAQWENAAGVLTAGLNSQQANTLHAFLDESRSAALSTYYIRQVAKAAAA
IKSRDDLYQYLLIDNQVSAAIKTTRIAEAIASIQLYVNRALENVEENANSGVISRQFFID
WDKYNKRYSTWAGVSQLVYYPENYIDPTMRIGQTKMMDALLQSVSQSQLNADTVEDAFMS
YLTSFEQVANLKVISAYHDNINNDQGLTYFIGLSETDAGEYYWRSVDHSKFNDGKFAANA
WSEWHKIDCPINPYKSTIRPVIYKSRLYLLWLEQKEITKQTGNSKDGYQTETDYRYELKL
AHIRYDGTWNTPITFDVNKKISELKLEKNRAPGLYCAGYQGEDTLLVMFYNQQDTLDSYK
NASMQGLYIFADMASKDMTPEQSNVYRDNSYQQFDTNNVRRVNNRYAEDYEIPSSVSSRK
DYGWGDYYLSMVYNGDIPTINYKAASSDLKIYISPKLRIIHNGYEGQKRNQCNLMNKYGK
LGDKFIVYTSLGVNPNNSSNKLMFYPVYQYSGNTSGLNQGRLLFHRDTTYPSKVEAWIPG
AKRSLTNQNAAIGDDYATDSLNKPDDLKQYIFMTDSKGTATDVSGPVEINTAISPAKVQI
IVKAGGKEQTFTADKDVSIQPSPSFDEMNYQFNALEIDGSGLNFINNSASIDVTFTAFAE
DGRKLGYESFSIPVTLKVSTDNALTLHHNENGAQYMQWQSYRTRLNTLFARQLVARATTG
IDTILSMETQNIQEPQLGKGFYATFVIPPYNLSTHGDERWFKLYIKHVVDNNSHIIYSGQ
LTDTNINITLFIPLDDVPLNQDYHAKVYMTFKKSPSDGTWWGPHFVRDDKGIVTINPKSI
LTHFESVNVLNNISSEPMDFSGANSLYFWELFYYTPMLVAQRLLHEQNFDEANRWLKYVW
SPSGYIVHGQIQNYQWNVRPLLEDTSWNSDPLDSVDPDAVAQHDPMHYKVSTFMRTLDLL
IARGDHAYRQLERDTLNEAKMWYMQALHLLGDKPYLPLSTTWSDPRLDRAADITTQNAHD
SAIVALRQNIPTPAPLSLRSANTLTDLFLPQINEVMMNYWQTLAQRVYNLRHNLSIDGQP
LYLPIYATPADPKALLSAAVATSQGGGKLPESFMSLWRFPHMLENARGMVSQLTQFGSTL
QNIIERQDAEALNALLQNQAAELILTNLSIQDKTIEELDAEKTVLEKSKAGAQSRFDSYG
KLYDENINAGENQAMTLRASAAGLTTAVQASRLAGAAADLVPNIFGFAGGGSRWGAIAEA
TGYVMEFSANVMNTEADKISQSETYRRRRQEWEIQRNNAEAELKQIDAQLKSLAVRREAA
VLQKTSLKTQQEQTQSQLAFLQRKFSNQALYNWLRGRLAAIYFQFYDLAVARCLMAEQAY
RWELNDDSARFIKPGAWQGTYAGLLAGETLMLSLAQMEDAHLKRDKRALEVERTVSLAEV
YAGLPKDNGPFSLAQEIDKLVSQGSGSAGSGNNNLAFGAGTDTKTSLQASVSFADLKIRE
DYPASLGKIRRIKQISVTLPALLGPYQDVQAILSYGDKAGLANGCEALAVSHGMNDSGQF
QLDFNDGKFLPFEGIAIDQGTLTLSFPNASMPEKGKQATMLKTLNDIILHIRYTIK

Sequence of entity 2 (F), FASTA

>6H6F_2 TcdB2,TccC3,TccC3 (chains F)
MQNSQDFSITELSLPKGGGAITGMGEALTPTGPDGMAALSLPLPISAGRGYAPAFTLNYN
SGAGNSPFGLGWDCNVMTIRRRTHFGVPHYDETDTFLGPEGEVLVVADQPRDESTLQGIN
LGATFTVTGYRSRLESHFSRLEYWQPKTTGKTDFWLIYSPDGQVHLLGKSPQARISNPSQ
TTQTAQWLLEASVSSRGEQIYYQYRAEDDTGCEADEITHHLQATAQRYLHIVYYGNRTAS
ETLPGLDGSAPSQADWLFYLVFDYGERSNNLKTPPAFSTTGSWLCRQDRFSRYEYGFEIR
TRRLCRQVLMYHHLQALDSKITEHNGPTLVSRLILNYDESAIASTLVFVRRVGHEQDGNV
VTLPPLELAYQDFSPRHHAHWQPMDVLANFNAIQRWQLVDLKGEGLPGLLYQDKGAWWYR
SAQRLGEIGSDAVTWEKMQPLSVIPSLQSNASLVDINGDGQLDWVITGPGLRGYHSQRPD
GSWTRFTPLNALPVEYTHPRAQLADLMGAGLSDLVLIGPKSVRLYANTRDGFAKGKDVVQ
SGDITLPVPGADPRKLVAFSDVLGSGQAHLVEVSATKVTCWPNLGRGRFGQPITLPGFSQ
PATEFNPAQVYLADLDGSGPTDLIYVHTNRLDIFLNKSGNGFAEPVTLRFPEGLRFDHTC
QLQMADVQGLGVASLILSVPHMSPHHWRCDLTNMKPWLLNEMNNNMGVHHTLRYRSSSQF
WLDEKAAALTTGQTPVCYLPFPIHTLWQTETEDEISGNKLVTTLRYARGAWDGREREFRG
FGYVEQTDSHQLAQGNAPERTPPALTKNWYATGLPVIDNALSTEYWRDDQAFAGFSPRFT
TWQDNKDVPLTPEDDNSRYWFNRALKGQLLRSELYGLDDSTNKHVPYTVTEFRSQVRRLQ
HTDSRYPVLWSSVVESRNYHYERIASDPQCSQNITLSSDRFGQPLKQLSVQYPRRQQPAI
NLYPDTLPDKLLANSYDDQQRQLRLTYQQSSWHHLTNNTVRVLGLPDSTRSDIFTYGAEN
VPAGGLNLELLSDKNSLIADDKPREYLGQQKTAYTDGQNTTPLQTPTRQALIAFTETTVF
NQSTLSAFNGSIPSDKLSTTLEQAGYQQTNYLFPRTGEDKVWVAHHGYTDYGTAAQFWRP
QKQSNTQLTGKITLIWDANYCVVVQTRDAAGLTTSAKYDWRFLTPVQLTDINDNQHLITL
DALGRPITLRFWGTENGKMTGYSSPEKASFSPPSDVNAAIELKKPLPVAQCQVYAPESWM
PVLSQKTFNRLAEQDWQKLYNARIITEDGRICTLAYRRWVQSQKAIPQLISLLNNGPRLP
PHSLTLTTDRYDHDPEQQIRQQVVFSDGFGRLLQAAARHEAGMARQRNEDGSLIINVQHT
ENRWAVTGRTEYDNKGQPIRTYQPYFLNDWRYVSNDSARQEKEAYADTHVYDPIGREIKV
ITAKGWFRRTLFTPWFTVNEDENDTAAEVKKVKMMKNIDPKLYQKTPTVSVYDNRGLIIR
NIDFHRTTANGDPDTRITRHQYDIHGHLNQSIDPRLYEAKQTNNTIKPNFLWQYDLTGNP
LCTESIDAGRTVTLNDIEGRPLLTVTATGVIQTRQYETSSLPGRLLSVAEQTPEEKTSRI
TERLIWAGNTEAEKDHNLAGQCVRHYDTAGVTRLESLSLTGTVLSQSSQLLIDTQEANWT
GDNETVWQNMLADDIYTTLSTFDATGALLTQTDAKGNIQRLAYDVAGQLNGSWLTLKGQT
EQVIIKSLTYSAAGQKLREEHGNDVITEYSYEPETQRLIGIKTRRPSDTKVLQDLRYEYD
PVGNVISIRNDAEATRFWHNQKVMPENTYTYDSLYQLISATGREMANIGQQSHQFPSPAL
PSDNNTYTNYTRTYTYDRGGNLTKIQHSSPATQNNYTTNITVSNRSNRAVLSTLTEDPAQ
VDALFDAGGHQNTLISGQNLNWNTRGELQQVTLVKRDKGANDDREWYRYSGDGRRMLKIN
EQQASNNAQTQRVTYLPNLELRLTQNSTATTEDLQVITVGEAGRAQVRVLHWESGKPEDI
DNNQLRYSYDNLIGSSQLELDSEGQIISEEEYYPYGGTALWAARNQTEASYKTIRYSGKE
RDATGLYYYGYRYYQPWIGRWLSSAPAGTIDGLNLYRMVRNNPVTLLDPDGLMPTIAERI
AALKKNKVTDSAPSPANATNVAINIRPPVAPKPSLPKASTSSQPTTHPIGAANIKPTTSG
SSIVAPLSPVGNKSTSEISLPESAQSSSSSTTSTNLQKKSFTLYRADNRSFEEMQSKFPE
GFKAWTPLDTKMARQFASIFIGQKDTSNLPKETVKNISTWGAKPKLKDLSNYIKYTKDKS
TVWVSTAINTEAGGQSSGAPLHKIDMDLYEFAIDGQKLNPLPEGRTKNMVPSLLLDTPQI
ETSSIIALNHGPVNDAEISFLTTIPLKNVKPHKR

Primary citation

Tc toxin activation requires unfolding and refolding of a beta-propeller. Gatsogiannis, C., Merino, F., Roderer, D. et al. Nature (2018) 563:209-213. DOI 10.1038/s41586-018-0556-6 · PubMed

Other PDB entries of the same protein (UniProt Q9RN43), best resolution first:

6RW6 2.75 Å, Cryo-EM structure of Photorhabdus luminescens TcdA1
6L7I 2.9 Å, Signal substraction of TcdB1-TccC2 and part of TcdA1
8CPZ 2.9 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K1179W mutant
6L7E 3.2 Å, Toxin Complex TcdA1-TcdB1-TccC2
8CQ0 3.2 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K567W K2008W mutant
6SUE 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore, Mutation TccC3-D651A
6SUF 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore
5LKH 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state (obtained by flexible fitting)
5LKI 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state
4O9Y 3.5 Å, Crystal Structure of TcdA1
8CQ2 3.6 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, C16S, C20S, C870S, T1279C…
6H6E 3.95 Å, PTC3 holotoxin complex from Photorhabdus luminecens in prepore state (TcdA1, TcdB2, TccC3)

Browse structure collections

About this viewer

MolViewer shows 6H6F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.