8CQ2: TcdA1

Name: PDB 8CQ2: Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, C16S, C20S, C870S, T1279C mutant
Published: 2024-03-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, C16S, C20S, C870S, T1279C mutant. Determined by electron microscopy at 3.6 Å resolution. Released 13 Mar 2024.

Method: Electron microscopy
Resolution: 3.6 Å
Organism: Photorhabdus luminescens
Chains: 5
Atoms: 84,390
Mol. weight: 1426.65 kDa
Released: 13 Mar 2024

Explore 8CQ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CQ2 contains 590 α-helices and 390 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 118 helices, 78 β-strands

Element	Residues	Length	Sheet
α-helix	93-96	4
β-strand	104	1	1
β-strand	111	1	2
α-helix	115-126	12
α-helix	138-141	4
α-helix	143-146	4
β-strand	149	1	3
α-helix	152-156	5
β-strand	160	1	4
α-helix	161-176	16
α-helix	182-189	8
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-230	6
α-helix	233-240	8
α-helix	245-252	8
α-helix	254-255	2
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-297	8
α-helix	300-303	4
β-strand	309	1	5
β-strand	312-317	6	5
β-strand	326-336	11	5
α-helix	338-340	3
β-strand	341-349	9	6
β-strand	352-359	8	6
β-strand	367-373	7	5
β-strand	376-382	7	5
α-helix	384-386	3
β-strand	387	1	6
β-strand	390-393	4	6
β-strand	396	1	6
α-helix	399-402	4
β-strand	405-413	9	5
β-strand	419-431	13	5
α-helix	434-449	16
α-helix	454-461	8
α-helix	472-487	16
α-helix	492-498	7
α-helix	502-504	3
α-helix	514-519	6
α-helix	523	1
β-strand	524	1	7
β-strand	527	1	7
β-strand	535-536	2	8
α-helix	540-542	3
α-helix	546-555	10
α-helix	559-569	11
β-strand	578-579	2	8
α-helix	582-597	16
α-helix	602-612	11
α-helix	614-616	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-678	14
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	749-769	21
α-helix	773-781	9
α-helix	788-789	2
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-839	8
α-helix	843-855	13
α-helix	871-887	17
α-helix	891-898	8
α-helix	908-911	4
α-helix	912-924	13
α-helix	928-953	26
α-helix	964-971	8
β-strand	982	1	4
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1044	4
α-helix	1055-1064	10
α-helix	1071-1089	19
β-strand	1092-1098	7	9
β-strand	1107-1113	7	9
β-strand	1121-1127	7	9
β-strand	1132	1	10
β-strand	1135	1	10
α-helix	1138-1140	3
β-strand	1145-1146	2	9
β-strand	1158-1163	6	11
β-strand	1166-1180	15	11
β-strand	1190-1202	13	11
β-strand	1203	1	12
β-strand	1209	1	12
α-helix	1210-1212	3
β-strand	1213-1216	4	11
α-helix	1218-1223	6
α-helix	1226-1227	2
α-helix	1231-1232	2
β-strand	1233-1238	6	13
α-helix	1239	1
β-strand	1244-1250	7	13
α-helix	1256-1259	4
β-strand	1265-1270	6	13
β-strand	1275-1277	3	13
α-helix	1278-1279	2
α-helix	1280-1290	11
α-helix	1291-1293	3
β-strand	1300-1301	2	14
α-helix	1302	1
β-strand	1303-1304	2	9
α-helix	1305-1306	2
α-helix	1582-1584	3
β-strand	1585-1588	4	14
β-strand	1594-1597	4	14
β-strand	1602-1604	3	14
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
α-helix	1632	1
β-strand	1633-1635	3	15
α-helix	1636	1
β-strand	1640-1647	8	16
α-helix	1648-1650	3
α-helix	1652-1654	3
β-strand	1660-1667	8	17
β-strand	1674-1680	7	17
β-strand	1686-1693	8	16
β-strand	1705-1711	7	17
β-strand	1724-1727	4	17
β-strand	1733-1735	3	17
β-strand	1746-1749	4	16
β-strand	1755-1757	3	15
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1799	11
β-strand	1800	1	18
β-strand	1805-1807	3	19
β-strand	1810-1812	3	19
β-strand	1816	1	18
α-helix	1819-1823	5
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	3
α-helix	1907-1914	8
β-strand	1949	1	2
α-helix	1950	1
β-strand	1951	1	1
α-helix	1952-1953	2
α-helix	1954-1971	18
β-strand	1974	1	20
β-strand	1980	1	20
α-helix	1983-1985	3
α-helix	1989-1993	5
β-strand	2006	1	21
α-helix	2009-2012	4
β-strand	2017	1	22
α-helix	2019-2104	86
α-helix	2111-2122	12
α-helix	2125-2139	15
β-strand	2146	1	23
β-strand	2148	1	24
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2294-2296	3
β-strand	2298	1	21
α-helix	2299-2301	3
α-helix	2306-2324	19
β-strand	2329-2336	8	25
α-helix	2337-2342	6
α-helix	2354-2360	7
β-strand	2367-2368	2	26
α-helix	2371-2373	3
β-strand	2375-2377	3	26
β-strand	2387-2392	6	26
α-helix	2393-2396	4
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	25
β-strand	2431-2435	5	26
α-helix	2442	1
β-strand	2447-2450	4	26
β-strand	2456	1	25
β-strand	2468	1	22
α-helix	2469-2470	2
β-strand	2476	1	25
β-strand	2481-2486	6	26
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2508-2515	8	25

Chain C: 118 helices, 78 β-strands

Element	Residues	Length	Sheet
α-helix	93-96	4
β-strand	104	1	52
β-strand	111	1	53
α-helix	115-126	12
α-helix	138-141	4
α-helix	143-146	4
β-strand	149	1	54
α-helix	152-156	5
β-strand	160	1	55
α-helix	161-176	16
α-helix	182-189	8
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-230	6
α-helix	233-240	8
α-helix	245-252	8
α-helix	254-255	2
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-297	8
α-helix	300-303	4
β-strand	309	1	56
β-strand	312-317	6	56
β-strand	326-336	11	56
α-helix	338-340	3
β-strand	341-349	9	57
β-strand	352-359	8	57
β-strand	367-373	7	56
β-strand	376-382	7	56
α-helix	384-386	3
β-strand	387	1	57
β-strand	390-393	4	57
β-strand	396	1	57
α-helix	399-402	4
β-strand	405-413	9	56
β-strand	419-431	13	56
α-helix	434-449	16
α-helix	454-461	8
α-helix	472-487	16
α-helix	492-498	7
α-helix	502-504	3
α-helix	514-519	6
α-helix	523	1
β-strand	524	1	58
β-strand	527	1	58
β-strand	535-536	2	59
α-helix	540-542	3
α-helix	546-555	10
α-helix	559-569	11
β-strand	578-579	2	59
α-helix	582-597	16
α-helix	602-612	11
α-helix	614-616	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-678	14
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	749-769	21
α-helix	773-781	9
α-helix	788-789	2
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-839	8
α-helix	843-855	13
α-helix	871-887	17
α-helix	891-898	8
α-helix	908-911	4
α-helix	912-924	13
α-helix	928-953	26
α-helix	964-971	8
β-strand	982	1	55
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1044	4
α-helix	1055-1064	10
α-helix	1071-1089	19
β-strand	1092-1098	7	60
β-strand	1107-1113	7	60
β-strand	1121-1127	7	60
β-strand	1132	1	61
β-strand	1135	1	61
α-helix	1138-1140	3
β-strand	1145-1146	2	60
β-strand	1158-1163	6	62
β-strand	1166-1180	15	62
β-strand	1190-1202	13	62
β-strand	1203	1	63
β-strand	1209	1	63
α-helix	1210-1212	3
β-strand	1213-1216	4	62
α-helix	1218-1223	6
α-helix	1226-1227	2
α-helix	1231-1232	2
β-strand	1233-1238	6	64
α-helix	1239	1
β-strand	1244-1250	7	64
α-helix	1256-1259	4
β-strand	1265-1270	6	64
β-strand	1275-1277	3	64
α-helix	1278-1279	2
α-helix	1280-1290	11
α-helix	1291-1293	3
β-strand	1300-1301	2	65
α-helix	1302	1
β-strand	1303-1304	2	60
α-helix	1305-1306	2
α-helix	1582-1584	3
β-strand	1585-1588	4	65
β-strand	1594-1597	4	65
β-strand	1602-1604	3	65
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
α-helix	1632	1
β-strand	1633-1635	3	66
α-helix	1636	1
β-strand	1640-1647	8	67
α-helix	1648-1650	3
α-helix	1652-1654	3
β-strand	1660-1667	8	68
β-strand	1674-1680	7	68
β-strand	1686-1693	8	67
β-strand	1705-1711	7	68
β-strand	1724-1727	4	68
β-strand	1733-1735	3	68
β-strand	1746-1749	4	67
β-strand	1755-1757	3	66
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1799	11
β-strand	1800	1	69
β-strand	1806-1807	2	70
β-strand	1810-1811	2	70
β-strand	1816	1	69
α-helix	1819-1823	5
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	54
α-helix	1907-1914	8
β-strand	1949	1	53
α-helix	1950	1
β-strand	1951	1	52
α-helix	1952-1953	2
α-helix	1954-1971	18
β-strand	1974	1	71
β-strand	1980	1	71
α-helix	1983-1985	3
α-helix	1989-1993	5
β-strand	2006	1	72
α-helix	2009-2012	4
β-strand	2017	1	73
α-helix	2019-2104	86
α-helix	2111-2122	12
α-helix	2125-2139	15
β-strand	2146	1	49
β-strand	2148	1	74
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2294-2296	3
β-strand	2298	1	72
α-helix	2299-2301	3
α-helix	2306-2324	19
β-strand	2329-2336	8	75
α-helix	2337-2342	6
α-helix	2354-2360	7
β-strand	2367-2368	2	76
α-helix	2371-2373	3
β-strand	2375-2377	3	76
β-strand	2387-2392	6	76
α-helix	2393-2396	4
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	75
β-strand	2431-2435	5	76
α-helix	2442	1
β-strand	2447-2450	4	76
β-strand	2456	1	75
β-strand	2468	1	73
α-helix	2469-2470	2
β-strand	2476	1	75
β-strand	2481-2486	6	76
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2508-2515	8	75

Chain D: 118 helices, 78 β-strands

Element	Residues	Length	Sheet
α-helix	93-96	4
β-strand	104	1	77
β-strand	111	1	78
α-helix	115-126	12
α-helix	138-141	4
α-helix	143-146	4
β-strand	149	1	79
α-helix	152-156	5
β-strand	160	1	80
α-helix	161-176	16
α-helix	182-189	8
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-230	6
α-helix	233-240	8
α-helix	245-252	8
α-helix	254-255	2
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-297	8
α-helix	300-303	4
β-strand	309	1	81
β-strand	312-317	6	81
β-strand	326-336	11	81
α-helix	338-340	3
β-strand	341-349	9	82
β-strand	352-359	8	82
β-strand	367-373	7	81
β-strand	376-382	7	81
α-helix	384-386	3
β-strand	387	1	82
β-strand	390-393	4	82
β-strand	396	1	82
α-helix	399-402	4
β-strand	405-413	9	81
β-strand	419-431	13	81
α-helix	434-449	16
α-helix	454-461	8
α-helix	472-487	16
α-helix	492-498	7
α-helix	502-504	3
α-helix	514-519	6
α-helix	523	1
β-strand	524	1	83
β-strand	527	1	83
β-strand	535-536	2	84
α-helix	540-542	3
α-helix	546-555	10
α-helix	559-569	11
β-strand	578-579	2	84
α-helix	582-597	16
α-helix	602-612	11
α-helix	614-616	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-678	14
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	749-769	21
α-helix	773-781	9
α-helix	788-789	2
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-839	8
α-helix	843-855	13
α-helix	871-887	17
α-helix	891-898	8
α-helix	908-911	4
α-helix	912-924	13
α-helix	928-953	26
α-helix	964-971	8
β-strand	982	1	80
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1044	4
α-helix	1055-1064	10
α-helix	1071-1089	19
β-strand	1092-1098	7	85
β-strand	1107-1113	7	85
β-strand	1121-1127	7	85
β-strand	1132	1	86
β-strand	1135	1	86
α-helix	1138-1140	3
β-strand	1145-1146	2	85
β-strand	1158-1163	6	87
β-strand	1166-1180	15	87
β-strand	1190-1202	13	87
β-strand	1203	1	88
β-strand	1209	1	88
α-helix	1210-1212	3
β-strand	1213-1216	4	87
α-helix	1218-1223	6
α-helix	1226-1227	2
α-helix	1231-1232	2
β-strand	1233-1238	6	89
α-helix	1239	1
β-strand	1244-1250	7	89
α-helix	1256-1259	4
β-strand	1265-1270	6	89
β-strand	1275-1277	3	89
α-helix	1278-1279	2
α-helix	1280-1290	11
α-helix	1291-1293	3
β-strand	1300-1301	2	90
α-helix	1302	1
β-strand	1303-1304	2	85
α-helix	1305-1306	2
α-helix	1582-1584	3
β-strand	1585-1588	4	90
β-strand	1594-1597	4	90
β-strand	1602-1604	3	90
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
α-helix	1632	1
β-strand	1633-1635	3	91
α-helix	1636	1
β-strand	1640-1647	8	92
α-helix	1648-1650	3
α-helix	1652-1654	3
β-strand	1660-1667	8	93
β-strand	1674-1680	7	93
β-strand	1686-1693	8	92
β-strand	1705-1711	7	93
β-strand	1724-1727	4	93
β-strand	1733-1735	3	93
β-strand	1746-1749	4	92
β-strand	1755-1757	3	91
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1799	11
β-strand	1800	1	94
β-strand	1806-1807	2	95
β-strand	1810-1811	2	95
β-strand	1816	1	94
α-helix	1819-1823	5
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	79
α-helix	1907-1914	8
β-strand	1949	1	78
α-helix	1950	1
β-strand	1951	1	77
α-helix	1952-1953	2
α-helix	1954-1971	18
β-strand	1974	1	96
β-strand	1980	1	96
α-helix	1983-1985	3
α-helix	1989-1993	5
β-strand	2006	1	97
α-helix	2009-2012	4
β-strand	2017	1	98
α-helix	2019-2104	86
α-helix	2111-2122	12
α-helix	2125-2139	15
β-strand	2146	1	74
β-strand	2148-2150	3	99
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2294-2296	3
β-strand	2298	1	97
α-helix	2299-2301	3
α-helix	2306-2324	19
β-strand	2329-2336	8	100
α-helix	2337-2342	6
α-helix	2354-2360	7
β-strand	2367-2368	2	101
α-helix	2371-2373	3
β-strand	2375-2377	3	101
β-strand	2387-2392	6	101
α-helix	2393-2396	4
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	100
β-strand	2431-2435	5	101
α-helix	2442	1
β-strand	2447-2450	4	101
β-strand	2456	1	100
β-strand	2468	1	98
α-helix	2469-2470	2
β-strand	2476	1	100
β-strand	2481-2486	6	101
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2508-2515	8	100

Chain E: 118 helices, 78 β-strands

Element	Residues	Length	Sheet
α-helix	93-96	4
β-strand	104	1	102
β-strand	111	1	103
α-helix	115-126	12
α-helix	138-141	4
α-helix	143-146	4
β-strand	149	1	104
α-helix	152-156	5
β-strand	160	1	105
α-helix	161-176	16
α-helix	182-189	8
α-helix	202-214	13
α-helix	216-218	3
α-helix	219-223	5
α-helix	225-230	6
α-helix	233-240	8
α-helix	245-252	8
α-helix	254-255	2
α-helix	260-267	8
α-helix	273-277	5
α-helix	279-286	8
α-helix	290-297	8
α-helix	300-303	4
β-strand	309	1	106
β-strand	312-317	6	106
β-strand	326-336	11	106
α-helix	338-340	3
β-strand	341-349	9	107
β-strand	352-359	8	107
β-strand	367-373	7	106
β-strand	376-382	7	106
α-helix	384-386	3
β-strand	387	1	107
β-strand	390-393	4	107
β-strand	396	1	107
α-helix	399-402	4
β-strand	405-413	9	106
β-strand	419-431	13	106
α-helix	434-449	16
α-helix	454-461	8
α-helix	472-487	16
α-helix	492-498	7
α-helix	502-504	3
α-helix	514-519	6
α-helix	523	1
β-strand	524	1	108
β-strand	527	1	108
β-strand	535-536	2	109
α-helix	540-542	3
α-helix	546-555	10
α-helix	559-569	11
β-strand	578-579	2	109
α-helix	582-597	16
α-helix	602-612	11
α-helix	614-616	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-678	14
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	749-769	21
α-helix	773-781	9
α-helix	788-789	2
α-helix	793-795	3
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-839	8
α-helix	843-855	13
α-helix	871-887	17
α-helix	891-898	8
α-helix	908-911	4
α-helix	912-924	13
α-helix	928-953	26
α-helix	964-971	8
β-strand	982	1	105
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1044	4
α-helix	1055-1064	10
α-helix	1071-1089	19
β-strand	1092-1098	7	110
β-strand	1107-1113	7	110
β-strand	1121-1127	7	110
β-strand	1132	1	111
β-strand	1135	1	111
α-helix	1138-1140	3
β-strand	1145-1146	2	110
β-strand	1158-1163	6	112
β-strand	1166-1180	15	112
β-strand	1190-1202	13	112
β-strand	1203	1	113
β-strand	1209	1	113
α-helix	1210-1212	3
β-strand	1213-1216	4	112
α-helix	1218-1223	6
α-helix	1226-1227	2
α-helix	1231-1232	2
β-strand	1233-1238	6	114
α-helix	1239	1
β-strand	1244-1250	7	114
α-helix	1256-1259	4
β-strand	1265-1270	6	114
β-strand	1275-1277	3	114
α-helix	1278-1279	2
α-helix	1280-1290	11
α-helix	1291-1293	3
β-strand	1300-1301	2	115
α-helix	1302	1
β-strand	1303-1304	2	110
α-helix	1305-1306	2
α-helix	1582-1584	3
β-strand	1585-1588	4	115
β-strand	1594-1597	4	115
β-strand	1602-1604	3	115
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1630	4
α-helix	1632	1
β-strand	1633-1635	3	116
α-helix	1636	1
β-strand	1640-1647	8	117
α-helix	1648-1650	3
α-helix	1652-1654	3
β-strand	1660-1667	8	118
β-strand	1674-1680	7	118
β-strand	1686-1693	8	117
β-strand	1705-1711	7	118
β-strand	1724-1727	4	118
β-strand	1733-1735	3	118
β-strand	1746-1749	4	117
β-strand	1755-1757	3	116
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1799	11
β-strand	1800	1	119
β-strand	1806-1807	2	120
β-strand	1810-1811	2	120
β-strand	1816	1	119
α-helix	1819-1823	5
α-helix	1837-1843	7
α-helix	1846-1868	23
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	104
α-helix	1907-1914	8
β-strand	1949	1	103
α-helix	1950	1
β-strand	1951	1	102
α-helix	1952-1953	2
α-helix	1954-1971	18
β-strand	1974	1	121
β-strand	1980	1	121
α-helix	1983-1985	3
α-helix	1989-1993	5
β-strand	2006	1	122
α-helix	2009-2012	4
β-strand	2017	1	123
α-helix	2019-2104	86
α-helix	2111-2122	12
α-helix	2125-2139	15
β-strand	2144-2146	3	99
β-strand	2148	1	23
α-helix	2156-2243	88
α-helix	2248-2283	36
α-helix	2294-2296	3
β-strand	2298	1	122
α-helix	2299-2301	3
α-helix	2306-2324	19
β-strand	2329-2336	8	124
α-helix	2337-2342	6
α-helix	2354-2360	7
β-strand	2367-2368	2	125
α-helix	2371-2373	3
β-strand	2375-2377	3	125
β-strand	2387-2392	6	125
α-helix	2393-2396	4
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	124
β-strand	2431-2435	5	125
α-helix	2442	1
β-strand	2447-2450	4	125
β-strand	2456	1	124
β-strand	2468	1	123
α-helix	2469-2470	2
β-strand	2476	1	124
β-strand	2481-2486	6	125
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2508-2515	8	124

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TcdA1	A, B, C, D, E	protein	2535	Photorhabdus luminescens	Q9RN43

Sequence of entity 1 (A, B, C, D, E), FASTA

>8CQ2_1 TcdA1 (chains A, B, C, D, E)
MAHHHHHHSSGLEVLFQGPMNESVKEIPDVLKSQSGFNSLTDISHSSFNEFRQQVSEHLS
WSETHDLYHDAQQAQKDNRLYEARILKRANPQLQNAVHLAILAPNAELIGYNNQFSGRAS
QYVAPGTVSSMFSPAAYLTELYREARNLHASDSVYYLDTRRPDLKSMALSQQNMDIELST
LSLSNELLLESIKTESKLENYTKVMEMLSTFRPSGATPYHDAYENVREVIQLQDPGLEQL
NASPAIAGLMHQASLLGINASISPELFNILTEEITEGNAEELYKKNFGNIEPASLAMPEY
LKRYYNLSDEELSQFIGKASNFGQQEYSNNQLITPVVNSSDGTVKVYRITREYTTNAYQM
DVELFPFGGENYRLDYKFKNFYNASYLSIKLNDKRELVRTEGAPQVNIEYSANITLNTAD
ISQPFEIGLTRVLPSGSWAYAAAKFTVEEYNQYSFLLKLNKAIRLSRATELSPTILEGIV
RSVNLQLDINTDVLGKVFLTKYYMQRYAIHAETALILCNAPISQRSYDNQPSQFDRLFNT
PLLNGQYFSTGDEEIDLNSGSTGDWRKTILKRAFNIDDVSLFRLLKITDHDNKDGKIKNN
LKNLSNLYIGKLLADIHQLTIDELDLLLIAVGEGKTNLSAISDKQLATLIRKLNTITSWL
HTQKWSVFQLFIMTSTSYNKTLTPEIKNLLDTVYHGLQGFDKDKADLLHVMAPYIAATLQ
LSSENVAHSVLLWADKLQPGDGAMTAEKFWDWLNTKYTPGSSEAVETQEHIVQYCQALAQ
LEMVYHSTGINENAFRLFVTKPEMFGAATGAAPAHDALSLIMLTRFADWVNALGEKASSV
LAAFEANSLTAEQLADAMNLDANLLLQASIQAQNHQHLPPVTPENAFSSWTSINTILQWV
NVAQQLNVAPQGVSALVGLDYIQSMKETPTYAQWENAAGVLTAGLNSQQANTLHAFLDES
RSAALSTYYIRQVAKAAAAIKSRDDLYQYLLIDNQVSAAIKTTRIAEAIASIQLYVNRAL
ENVEENANSGVISRQFFIDWDKYNKRYSTWAGVSQLVYYPENYIDPTMRIGQTKMMDALL
QSVSQSQLNADTVEDAFMSYLTSFEQVANLKVISAYHDNINNDQGLTYFIGLSETDAGEY
YWRSVDHSKFNDGKFAANAWSEWHKIDCPINPYKSTIRPVIYKSRLYLLWLEQKEITKQT
GNSKDGYQTETDYRYELKLAHIRYDGTWNTPITFDVNKKISELKLEKNRAPGLYCAGYQG
EDTLLVMFYNQQDTLDSYKNASMQGLYIFADMASKDMCPEQSNVYRDNSYQQFDTNNVRR
VNNRYAEDYEIPSSVSSRKDYGWGDYYLSMVYNGDIPTINYKAASSDLKIYISPKLRIIH
NGYEGQKRNQCNLMNKYGKLGDKFIVYTSLGVNPNNSSNKLMFYPVYQYSGNTSGLNQGR
LLFHRDTTYPSKVEAWIPGAKRSLTNQNAAIGDDYATDSLNKPDDLKQYIFMTDSKGTAT
DVSGPVEINTAISPAKVQIIVKAGGKEQTFTADKDVSIQPSPSFDEMNYQFNALEIDGSG
LNFINNSASIDVTFTAFAEDGRKLGYESFSIPVTLKVSTDNALTLHHNENGAQYMQWQSY
RTRLNTLFARQLVARATTGIDTILSMETQNIQEPQLGKGFYATFVIPPYNLSTHGDERWF
KLYIKHVVDNNSHIIYSGQLTDTNINITLFIPLDDVPLNQDYHAKVYMTFKKSPSDGTWW
GPHFVRDDKGIVTINPKSILTHFESVNVLNNISSEPMDFSGANSLYFWELFYYTPMLVAQ
RLLHEQNFDEANRWLKYVWSPSGYIVHGQIQNYQWNVRPLLEDTSWNSDPLDSVDPDAVA
QHDPMHYKVSTFMRTLDLLIARGDHAYRQLERDTLNEAKMWYMQALHLLGDKPYLPLSTT
WSDPRLDRAADITTQNAHDSAIVALRQNIPTPAPLSLRSANTLTDLFLPQINEVMMNYWQ
TLAQRVYNLRHNLSIDGQPLYLPIYATPADPKALLSAAVATSQGGGKLPESFMSLWRFPH
MLENARGMVSQLTQFGSTLQNIIERQDAEALNALLQNQAAELILTNLSIQDKTIEELDAE
KTVLEKSKAGAQSRFDSYGKLYDENINAGENQAMTLRASAAGLTTAVQASRLAGAAADLV
PNIFGFAGGGSRWGAIAEATGYVMEFSANVMNTEADKISQSETYRRRRQEWEIQRNNAEA
ELKQIDAQLKSLAVRREAAVLQKTSLKTQQEQTQSQLAFLQRKFSNQALYNWLRGRLAAI
YFQFYDLAVARCLMAEQAYRWELNDDSARFIKPGAWQGTYAGLLAGETLMLSLAQMEDAH
LKRDKRALEVERTVSLAEVYAGLPKDNGPFSLAQEIDKLVSQGSGSAGSGNNNLAFGAGT
DTKTSLQASVSFADLKIREDYPASLGKIRRIKQISVTLPALLGPYQDVQAILSYGDKAGL
ANGCEALAVSHGMNDSGQFQLDFNDGKFLPFEGIAIDQGTLTLSFPNASMPEKGKQATML
KTLNDIILHIRYTIK

Primary citation

Multistate kinetics of the syringe-like injection mechanism of Tc toxins. Ng'ang'a, P.N., Folz, J., Kucher, S. et al. Sci Adv (2025) 11:eadr2019-eadr2019. DOI 10.1126/sciadv.adr2019 · PubMed

Other PDB entries of the same protein (UniProt Q9RN43), best resolution first:

6RW6 2.75 Å, Cryo-EM structure of Photorhabdus luminescens TcdA1
6L7I 2.9 Å, Signal substraction of TcdB1-TccC2 and part of TcdA1
8CPZ 2.9 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K1179W mutant
6L7E 3.2 Å, Toxin Complex TcdA1-TcdB1-TccC2
8CQ0 3.2 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K567W K2008W mutant
6SUE 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore, Mutation TccC3-D651A
6SUF 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore
5LKH 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state (obtained by flexible fitting)
5LKI 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state
4O9Y 3.5 Å, Crystal Structure of TcdA1
6H6F 3.72 Å, PTC3 holotoxin complex from Photorhabdus luminiscens - Mutant TcC-D651A
6H6E 3.95 Å, PTC3 holotoxin complex from Photorhabdus luminecens in prepore state (TcdA1, TcdB2, TccC3)

Browse structure collections

About this viewer

MolViewer shows 8CQ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.