6H6E: TcdA1

Name: PDB 6H6E: PTC3 holotoxin complex from Photorhabdus luminecens in prepore state (TcdA1, TcdB2, TccC3)
Published: 2018-10-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

PTC3 holotoxin complex from Photorhabdus luminecens in prepore state (TcdA1, TcdB2, TccC3). Determined by electron microscopy at 3.95 Å resolution. Released 3 Oct 2018.

Method: Electron microscopy
Resolution: 3.95 Å
Organism: Photorhabdus luminescens
Chains: 6
Atoms: 112,922
Mol. weight: 1689.83 kDa
Released: 3 Oct 2018

Explore 6H6E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H6E contains 723 α-helices and 734 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 126 helices, 115 β-strands

Element	Residues	Length	Sheet
α-helix	72-75	4
α-helix	78-80	3
α-helix	82-84	3
α-helix	87-95	9
α-helix	99-101	3
β-strand	104	1	1
β-strand	111	1	2
α-helix	115-126	12
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	3
α-helix	152-156	5
β-strand	159-160	2	4
α-helix	161-176	16
α-helix	182-190	9
α-helix	202-214	13
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	253-255	3
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-301	3	5
β-strand	305-307	3	5
β-strand	309	1	6
β-strand	312-319	8	6
β-strand	322-336	15	6
α-helix	338-340	3
β-strand	341-349	9	7
β-strand	352-359	8	7
β-strand	367-372	6	6
β-strand	376-382	7	6
α-helix	384-386	3
β-strand	387	1	7
β-strand	390-396	7	7
α-helix	399-403	5
β-strand	406-413	8	6
β-strand	419-432	14	6
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	502-504	3
β-strand	508	1	8
β-strand	511	1	8
α-helix	514-519	6
β-strand	524	1	9
β-strand	527	1	9
α-helix	528-529	2
β-strand	535-537	3	10
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	10
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-700	13
α-helix	705-718	14
α-helix	727-736	10
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	788-789	2
α-helix	792-795	4
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-839	8
α-helix	843-855	13
α-helix	871-887	17
α-helix	891-898	8
α-helix	904-907	4
α-helix	909-911	3
α-helix	912-923	12
α-helix	928-953	26
α-helix	964-971	8
β-strand	982-983	2	4
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1063	9
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	11
β-strand	1107-1113	7	11
β-strand	1121-1127	7	11
α-helix	1128-1130	3
β-strand	1131-1132	2	12
β-strand	1135-1136	2	12
α-helix	1138-1140	3
β-strand	1141	1	11
β-strand	1145-1146	2	11
α-helix	1154-1156	3
β-strand	1158-1163	6	13
β-strand	1166-1178	13	13
β-strand	1192-1202	11	13
β-strand	1203	1	14
β-strand	1209	1	14
β-strand	1213-1216	4	13
α-helix	1218-1223	6
β-strand	1233-1239	7	15
α-helix	1241-1243	3
β-strand	1244-1250	7	15
α-helix	1256-1261	6
β-strand	1265-1269	5	15
β-strand	1275-1277	3	15
α-helix	1278-1279	2
α-helix	1280-1290	11
α-helix	1291-1293	3
β-strand	1296	1	16
β-strand	1299	1	16
β-strand	1300-1302	3	17
β-strand	1303-1304	2	11
β-strand	1306	1	15
β-strand	1310-1311	2	18
β-strand	1316	1	19
β-strand	1321-1324	4	18
α-helix	1326-1328	3
β-strand	1331-1332	2	18
β-strand	1336	1	18
β-strand	1337	1	19
β-strand	1340-1345	6	20
β-strand	1348-1353	6	20
β-strand	1356-1360	5	18
α-helix	1367-1378	12
β-strand	1384-1393	10	21
β-strand	1405-1409	5	21
α-helix	1410	1
β-strand	1412	1	22
β-strand	1415	1	22
β-strand	1421-1425	5	21
β-strand	1433-1438	6	21
β-strand	1443-1448	6	21
α-helix	1450-1451	2
β-strand	1454-1458	5	21
α-helix	1464-1467	4
β-strand	1471-1474	4	21
β-strand	1480-1490	11	21
α-helix	1495-1497	3
β-strand	1498-1504	7	18
β-strand	1507-1512	6	18
α-helix	1513-1516	4
α-helix	1520-1523	4
β-strand	1528-1531	4	18
β-strand	1535-1538	4	20
β-strand	1545	1	18
β-strand	1548-1559	12	18
β-strand	1563-1576	14	18
α-helix	1577-1578	2
α-helix	1582-1583	2
β-strand	1584-1589	6	17
β-strand	1593-1598	6	17
β-strand	1601-1604	4	17
α-helix	1609-1613	5
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1633-1635	3	23
β-strand	1640-1647	8	24
α-helix	1648-1650	3
β-strand	1660-1668	9	25
β-strand	1670-1680	11	25
β-strand	1686-1693	8	24
β-strand	1705-1711	7	25
β-strand	1714	1	25
β-strand	1721	1	26
β-strand	1724-1727	4	25
β-strand	1733-1735	3	25
β-strand	1740	1	26
β-strand	1746-1750	5	24
β-strand	1755-1757	3	23
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	27
β-strand	1806-1807	2	28
β-strand	1810-1811	2	28
β-strand	1816	1	27
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1869	24
α-helix	1873-1890	18
α-helix	1893-1895	3
β-strand	1906	1	3
α-helix	1907-1911	5
α-helix	1913-1921	9
α-helix	1944-1946	3
α-helix	1948	1
β-strand	1949	1	2
α-helix	1950	1
β-strand	1951	1	1
α-helix	1954-1971	18
β-strand	1974	1	29
β-strand	1980	1	29
α-helix	1986-1992	7
β-strand	2006	1	30
α-helix	2007-2012	6
β-strand	2017	1	31
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2138	14
β-strand	2144-2145	2	32
β-strand	2148-2150	3	32
α-helix	2156-2243	88
α-helix	2248-2284	37
β-strand	2298	1	30
α-helix	2299-2301	3
α-helix	2306-2323	18
β-strand	2329-2336	8	33
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	34
β-strand	2373-2377	5	34
α-helix	2381-2383	3
β-strand	2387-2392	6	34
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	33
β-strand	2422-2423	2	35
β-strand	2431-2435	5	34
α-helix	2441-2442	2
β-strand	2447-2450	4	34
β-strand	2456	1	33
β-strand	2468	1	31
α-helix	2469-2470	2
β-strand	2476	1	33
β-strand	2481-2486	6	34
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2508-2515	8	33

Chain B: 134 helices, 113 β-strands

Element	Residues	Length	Sheet
α-helix	72-75	4
α-helix	82-84	3
α-helix	87-95	9
α-helix	99-101	3
β-strand	104	1	36
β-strand	111	1	37
α-helix	115-126	12
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	38
α-helix	152-156	5
β-strand	159-160	2	39
α-helix	161-176	16
α-helix	182-190	9
α-helix	202-214	13
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	253-255	3
α-helix	257-259	3
α-helix	260-268	9
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-301	3	40
β-strand	305-307	3	40
β-strand	309	1	41
β-strand	312-319	8	41
β-strand	322-336	15	41
α-helix	338-340	3
β-strand	341-350	10	42
β-strand	352-359	8	42
β-strand	367-372	6	41
β-strand	376-382	7	41
α-helix	385-386	2
β-strand	390-396	7	42
α-helix	399-402	4
β-strand	406-413	8	41
β-strand	419-432	14	41
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	501-504	4
β-strand	508	1	43
β-strand	511	1	43
α-helix	514-519	6
β-strand	524	1	44
β-strand	527	1	44
α-helix	528-529	2
β-strand	535-537	3	45
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	45
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-699	12
α-helix	705-718	14
α-helix	727-737	11
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	788-789	2
α-helix	792-795	4
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-839	8
α-helix	843-855	13
α-helix	871-887	17
α-helix	891-898	8
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-923	12
α-helix	928-949	22
α-helix	950-954	5
α-helix	964-971	8
β-strand	982-983	2	39
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1020-1022	3
α-helix	1028-1036	9
α-helix	1041-1043	3
α-helix	1055-1063	9
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	46
β-strand	1107-1113	7	46
β-strand	1121-1127	7	46
α-helix	1128-1130	3
β-strand	1131-1132	2	47
β-strand	1135-1136	2	47
α-helix	1138-1140	3
β-strand	1141	1	46
α-helix	1142-1144	3
β-strand	1145-1146	2	46
α-helix	1154-1156	3
β-strand	1158-1163	6	48
β-strand	1166-1178	13	48
β-strand	1192-1202	11	48
β-strand	1203	1	49
β-strand	1209	1	49
β-strand	1213-1216	4	48
α-helix	1218-1222	5
α-helix	1230-1232	3
β-strand	1233-1239	7	50
α-helix	1241-1243	3
β-strand	1244-1250	7	50
α-helix	1256-1261	6
β-strand	1265-1269	5	50
β-strand	1275-1277	3	50
α-helix	1278-1279	2
α-helix	1280-1290	11
α-helix	1291-1293	3
β-strand	1296	1	51
β-strand	1299	1	51
β-strand	1300-1301	2	52
β-strand	1303	1	46
β-strand	1310-1311	2	53
β-strand	1316	1	54
β-strand	1321-1324	4	53
α-helix	1326-1328	3
β-strand	1331-1332	2	53
β-strand	1336	1	53
β-strand	1337	1	54
β-strand	1340-1345	6	55
β-strand	1348-1353	6	55
β-strand	1356-1360	5	53
α-helix	1367-1378	12
β-strand	1384-1393	10	56
β-strand	1407-1409	3	56
α-helix	1410	1
β-strand	1412	1	57
β-strand	1415	1	57
β-strand	1421-1425	5	56
β-strand	1432-1438	7	56
α-helix	1439-1441	3
β-strand	1443-1450	8	56
α-helix	1451	1
β-strand	1454-1458	5	56
α-helix	1464-1467	4
β-strand	1471-1474	4	56
β-strand	1480-1490	11	56
α-helix	1495-1497	3
β-strand	1498-1504	7	53
β-strand	1507-1512	6	53
α-helix	1513-1516	4
α-helix	1520-1523	4
β-strand	1528-1531	4	53
β-strand	1535-1538	4	55
β-strand	1545	1	53
β-strand	1548-1559	12	53
β-strand	1563-1576	14	53
α-helix	1582-1584	3
β-strand	1585-1589	5	52
β-strand	1593-1598	6	52
β-strand	1601-1604	4	52
α-helix	1609-1616	8
α-helix	1617-1619	3
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1633-1635	3	58
β-strand	1640-1647	8	59
α-helix	1648-1650	3
α-helix	1652-1655	4
β-strand	1660-1668	9	60
β-strand	1670-1680	11	60
β-strand	1686-1693	8	59
β-strand	1705-1711	7	60
β-strand	1714	1	60
β-strand	1721-1722	2	61
β-strand	1724-1727	4	60
β-strand	1733-1735	3	60
β-strand	1740	1	61
β-strand	1746-1749	4	59
β-strand	1755-1757	3	58
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1796	8
β-strand	1800	1	62
β-strand	1806-1807	2	63
β-strand	1810-1811	2	63
β-strand	1816	1	62
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1870	25
α-helix	1873-1890	18
α-helix	1893-1894	2
β-strand	1906	1	38
α-helix	1907-1910	4
α-helix	1913-1921	9
α-helix	1944-1946	3
α-helix	1948	1
β-strand	1949	1	37
α-helix	1950	1
β-strand	1951	1	36
α-helix	1952	1
α-helix	1954-1971	18
β-strand	1974	1	64
β-strand	1980	1	64
α-helix	1986-1992	7
α-helix	2000-2002	3
β-strand	2006	1	65
α-helix	2007-2012	6
β-strand	2017	1	66
α-helix	2019-2105	87
α-helix	2109-2122	14
α-helix	2125-2139	15
β-strand	2144-2146	3	32
β-strand	2148-2150	3	32
α-helix	2156-2243	88
α-helix	2248-2284	37
β-strand	2298	1	65
α-helix	2299-2301	3
α-helix	2306-2322	17
α-helix	2328	1
β-strand	2329-2336	8	67
α-helix	2337-2342	6
α-helix	2353-2362	10
β-strand	2367-2370	4	68
β-strand	2373-2377	5	68
α-helix	2381-2383	3
β-strand	2387-2392	6	68
α-helix	2393-2396	4
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	67
β-strand	2423	1	69
β-strand	2431-2435	5	68
α-helix	2441-2442	2
β-strand	2447-2450	4	68
β-strand	2456	1	67
β-strand	2468	1	66
α-helix	2469-2470	2
β-strand	2476	1	67
β-strand	2481-2486	6	68
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2508-2515	8	67

Chain C: 134 helices, 110 β-strands

Element	Residues	Length	Sheet
α-helix	72-75	4
α-helix	78-80	3
α-helix	87-95	9
α-helix	99-101	3
β-strand	104	1	70
β-strand	111	1	71
α-helix	117-126	10
α-helix	138-141	4
α-helix	143-146	4
β-strand	149	1	72
α-helix	152-156	5
β-strand	159-160	2	73
α-helix	161-176	16
α-helix	182-190	9
α-helix	202-214	13
α-helix	219-223	5
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	260-267	8
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-301	3	74
β-strand	305-307	3	74
β-strand	309	1	75
β-strand	312-319	8	75
β-strand	322-336	15	75
α-helix	338-340	3
β-strand	341-349	9	76
β-strand	352-359	8	76
β-strand	367-372	6	75
β-strand	376-382	7	75
α-helix	384-386	3
β-strand	390-396	7	76
α-helix	399-402	4
β-strand	405-413	9	75
β-strand	419-432	14	75
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	502-504	3
β-strand	508	1	77
β-strand	511	1	77
α-helix	512-513	2
α-helix	514-519	6
β-strand	524	1	78
β-strand	527	1	78
α-helix	528-529	2
α-helix	534	1
β-strand	535-537	3	79
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	79
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	689-700	12
α-helix	705-718	14
α-helix	727-736	10
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	788-789	2
α-helix	792-795	4
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-839	8
α-helix	843-855	13
α-helix	871-887	17
α-helix	891-898	8
α-helix	904-907	4
α-helix	912-923	12
α-helix	928-953	26
α-helix	964-971	8
β-strand	982-983	2	73
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1020-1022	3
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1063	9
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	80
β-strand	1107-1113	7	80
α-helix	1119-1120	2
β-strand	1121-1127	7	80
α-helix	1128-1130	3
β-strand	1131-1132	2	81
β-strand	1135-1136	2	81
α-helix	1138-1140	3
β-strand	1141	1	80
α-helix	1142-1144	3
β-strand	1145-1146	2	80
α-helix	1154-1156	3
β-strand	1158-1163	6	82
β-strand	1166-1178	13	82
β-strand	1192-1202	11	82
β-strand	1203	1	83
β-strand	1209	1	83
β-strand	1213-1216	4	82
α-helix	1218-1222	5
α-helix	1231-1232	2
β-strand	1233-1237	5	84
β-strand	1239	1	85
α-helix	1241-1243	3
β-strand	1245-1250	6	84
α-helix	1256-1259	4
β-strand	1265-1269	5	84
β-strand	1275-1277	3	84
α-helix	1278-1279	2
α-helix	1280-1290	11
α-helix	1291-1293	3
β-strand	1296	1	86
β-strand	1299	1	86
β-strand	1301-1302	2	87
β-strand	1303	1	80
β-strand	1306	1	85
β-strand	1310-1311	2	88
β-strand	1316	1	89
β-strand	1321-1324	4	88
α-helix	1326-1328	3
β-strand	1331-1332	2	88
β-strand	1336-1345	10	88
β-strand	1348-1360	13	88
α-helix	1363-1364	2
α-helix	1367-1378	12
β-strand	1384-1393	10	90
β-strand	1404-1412	9	90
β-strand	1415-1426	12	90
β-strand	1434-1438	5	90
β-strand	1443-1447	5	90
α-helix	1450-1451	2
β-strand	1454-1458	5	90
α-helix	1459	1
α-helix	1464-1467	4
β-strand	1471-1474	4	90
β-strand	1480-1490	11	90
α-helix	1495-1497	3
β-strand	1498-1504	7	88
β-strand	1507-1512	6	88
α-helix	1513-1516	4
α-helix	1520-1523	4
β-strand	1528-1531	4	88
α-helix	1532-1534	3
β-strand	1535-1538	4	88
β-strand	1545	1	88
β-strand	1548-1559	12	88
β-strand	1563-1576	14	88
α-helix	1577-1578	2
α-helix	1582-1583	2
β-strand	1584-1588	5	87
β-strand	1594-1598	5	87
β-strand	1601-1604	4	87
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1629-1631	3
β-strand	1633-1635	3	91
β-strand	1640-1647	8	92
α-helix	1648-1650	3
α-helix	1652-1655	4
β-strand	1660-1666	7	93
β-strand	1668	1	94
β-strand	1670	1	94
β-strand	1674-1680	7	93
β-strand	1686-1693	8	92
β-strand	1705-1711	7	93
β-strand	1721-1722	2	95
β-strand	1724-1727	4	93
β-strand	1733-1735	3	93
β-strand	1740	1	95
β-strand	1746-1750	5	92
β-strand	1755-1757	3	91
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	96
β-strand	1806-1807	2	97
β-strand	1810-1811	2	97
β-strand	1816	1	96
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1870	25
α-helix	1873-1890	18
α-helix	1893-1894	2
β-strand	1906	1	72
α-helix	1907-1911	5
α-helix	1913-1921	9
α-helix	1944-1946	3
α-helix	1947-1948	2
β-strand	1949	1	71
α-helix	1950	1
β-strand	1951	1	70
α-helix	1954-1971	18
β-strand	1974	1	98
β-strand	1980	1	98
α-helix	1988-1992	5
α-helix	2000-2002	3
β-strand	2006	1	99
α-helix	2007-2015	9
β-strand	2017	1	100
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2139	15
β-strand	2144-2146	3	32
β-strand	2148-2150	3	101
α-helix	2156-2243	88
α-helix	2248-2284	37
β-strand	2298	1	99
α-helix	2306-2324	19
α-helix	2328	1
β-strand	2329-2336	8	102
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	103
β-strand	2373-2377	5	103
α-helix	2381-2383	3
β-strand	2387-2392	6	103
α-helix	2394-2396	3
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	102
β-strand	2431-2435	5	103
α-helix	2438-2440	3
α-helix	2442	1
β-strand	2447-2450	4	103
β-strand	2456	1	102
β-strand	2468	1	100
α-helix	2469-2470	2
β-strand	2476	1	102
β-strand	2481-2486	6	103
α-helix	2491-2493	3
α-helix	2500-2503	4
β-strand	2508-2515	8	102

Chain D: 135 helices, 114 β-strands

Element	Residues	Length	Sheet
α-helix	72-76	5
α-helix	78-80	3
α-helix	82-84	3
α-helix	87-95	9
α-helix	99-101	3
β-strand	104	1	104
β-strand	111	1	105
α-helix	115-126	12
α-helix	138-141	4
α-helix	143-147	5
β-strand	149	1	106
α-helix	152-156	5
β-strand	158-160	3	107
α-helix	161-176	16
α-helix	182-191	10
α-helix	202-214	13
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	260-268	9
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-301	3	108
β-strand	305-307	3	108
β-strand	309	1	109
β-strand	312-319	8	109
β-strand	322-336	15	109
α-helix	338-340	3
β-strand	341-349	9	110
β-strand	352-359	8	110
β-strand	367-372	6	109
β-strand	376-382	7	109
α-helix	384-386	3
β-strand	390-396	7	110
α-helix	399-402	4
β-strand	406-413	8	109
β-strand	419-432	14	109
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	502-504	3
β-strand	508	1	111
β-strand	511	1	111
α-helix	514-519	6
β-strand	524	1	112
β-strand	527	1	112
α-helix	528-529	2
β-strand	535-537	3	113
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	113
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-654	7
α-helix	665-677	13
α-helix	688-691	4
α-helix	693-700	8
α-helix	705-718	14
α-helix	727-736	10
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	788-789	2
α-helix	792-795	4
α-helix	798-814	17
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-838	7
α-helix	843-855	13
α-helix	871-887	17
α-helix	891-898	8
α-helix	904-907	4
α-helix	909-911	3
α-helix	912-923	12
α-helix	928-949	22
α-helix	950-954	5
α-helix	964-971	8
β-strand	982-984	3	107
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1044	4
α-helix	1055-1063	9
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	114
β-strand	1107-1113	7	114
β-strand	1121-1127	7	114
α-helix	1128-1130	3
β-strand	1131-1132	2	115
β-strand	1135-1136	2	115
α-helix	1138-1140	3
β-strand	1141	1	114
α-helix	1142-1144	3
β-strand	1145-1146	2	114
α-helix	1154-1156	3
β-strand	1158-1163	6	116
β-strand	1166-1178	13	116
β-strand	1192-1202	11	116
β-strand	1203	1	117
β-strand	1209	1	117
β-strand	1213-1216	4	116
α-helix	1218-1221	4
β-strand	1233-1239	7	118
α-helix	1241-1243	3
β-strand	1244-1250	7	118
α-helix	1256-1261	6
β-strand	1265-1269	5	118
β-strand	1275-1277	3	118
α-helix	1278-1279	2
α-helix	1280-1288	9
α-helix	1291-1293	3
β-strand	1296	1	119
β-strand	1299	1	119
β-strand	1300-1302	3	120
β-strand	1303	1	114
β-strand	1310-1311	2	121
β-strand	1316	1	122
β-strand	1321-1324	4	121
α-helix	1326-1328	3
β-strand	1331-1332	2	121
β-strand	1336	1	121
β-strand	1337	1	122
β-strand	1340-1345	6	123
β-strand	1348-1353	6	123
β-strand	1356-1360	5	121
α-helix	1363-1364	2
α-helix	1367-1378	12
β-strand	1384-1393	10	124
β-strand	1404-1409	6	124
α-helix	1410	1
β-strand	1412	1	125
β-strand	1415	1	125
β-strand	1421-1426	6	124
β-strand	1434-1438	5	124
β-strand	1443-1447	5	124
α-helix	1450-1451	2
β-strand	1454-1458	5	124
α-helix	1459	1
α-helix	1464-1467	4
β-strand	1471-1474	4	124
β-strand	1480-1490	11	124
α-helix	1495-1497	3
β-strand	1498-1504	7	121
β-strand	1507-1512	6	121
α-helix	1513-1516	4
α-helix	1520-1522	3
β-strand	1528-1531	4	121
β-strand	1535-1538	4	123
β-strand	1545	1	121
β-strand	1548-1558	11	121
β-strand	1564-1576	13	121
α-helix	1577	1
α-helix	1582-1583	2
β-strand	1584-1589	6	120
β-strand	1593-1598	6	120
β-strand	1601-1604	4	120
α-helix	1609-1617	9
α-helix	1621-1624	4
α-helix	1627-1631	5
β-strand	1633-1635	3	126
β-strand	1640-1647	8	127
α-helix	1648-1650	3
α-helix	1652-1655	4
β-strand	1660-1666	7	128
β-strand	1668	1	129
β-strand	1670	1	129
β-strand	1674-1680	7	128
β-strand	1686-1693	8	127
β-strand	1705-1711	7	128
β-strand	1714	1	128
β-strand	1721-1722	2	130
β-strand	1724-1727	4	128
β-strand	1733-1735	3	128
β-strand	1740	1	130
β-strand	1746-1750	5	127
β-strand	1755-1757	3	126
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1797	9
β-strand	1800	1	131
β-strand	1806-1807	2	132
β-strand	1810-1811	2	132
β-strand	1816	1	131
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1870	25
α-helix	1873-1890	18
α-helix	1893-1894	2
β-strand	1906	1	106
α-helix	1907-1911	5
α-helix	1913-1921	9
α-helix	1944-1946	3
α-helix	1948	1
β-strand	1949	1	105
α-helix	1950	1
β-strand	1951	1	104
α-helix	1952	1
α-helix	1954-1971	18
β-strand	1974	1	133
β-strand	1980	1	133
α-helix	1988-1992	5
β-strand	2006	1	134
α-helix	2007-2012	6
β-strand	2017	1	135
α-helix	2019-2105	87
α-helix	2109-2122	14
α-helix	2125-2138	14
β-strand	2144-2146	3	101
β-strand	2149-2150	2	32
α-helix	2156-2243	88
α-helix	2248-2284	37
β-strand	2298	1	134
α-helix	2299-2301	3
α-helix	2306-2324	19
α-helix	2328	1
β-strand	2329-2336	8	136
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	137
β-strand	2373-2377	5	137
β-strand	2387-2392	6	137
α-helix	2393-2396	4
α-helix	2398-2401	4
α-helix	2404-2406	3
β-strand	2410-2418	9	136
α-helix	2427-2429	3
β-strand	2431-2435	5	137
α-helix	2438-2440	3
β-strand	2447-2450	4	137
β-strand	2454-2456	3	136
β-strand	2468	1	135
α-helix	2469-2470	2
β-strand	2476	1	136
β-strand	2481-2486	6	137
α-helix	2491-2493	3
α-helix	2497-2500	4
α-helix	2501-2503	3
β-strand	2508-2515	8	136

Chain E: 129 helices, 112 β-strands

Element	Residues	Length	Sheet
α-helix	72-75	4
α-helix	78-80	3
α-helix	87-95	9
α-helix	99-101	3
β-strand	104	1	138
β-strand	111	1	139
α-helix	115-126	12
α-helix	138-141	4
α-helix	144-147	4
β-strand	149	1	140
α-helix	152-156	5
β-strand	158-160	3	141
α-helix	161-176	16
α-helix	182-190	9
α-helix	202-214	13
α-helix	219-222	4
α-helix	225-228	4
α-helix	233-240	8
α-helix	245-251	7
α-helix	253-255	3
α-helix	257-259	3
α-helix	260-265	6
α-helix	273-276	4
α-helix	279-285	7
α-helix	290-297	8
β-strand	299-301	3	142
β-strand	305-307	3	142
β-strand	309	1	143
β-strand	312-319	8	143
β-strand	322-336	15	143
β-strand	341-349	9	144
β-strand	352-359	8	144
β-strand	367-372	6	143
β-strand	376-382	7	143
α-helix	384-386	3
β-strand	390-396	7	144
α-helix	399-402	4
β-strand	405-413	9	143
β-strand	419-432	14	143
α-helix	433-450	18
α-helix	454-464	11
α-helix	472-488	17
α-helix	492-497	6
α-helix	502-504	3
β-strand	508	1	145
β-strand	511	1	145
α-helix	514-519	6
β-strand	524	1	146
β-strand	527	1	146
β-strand	535-537	3	147
α-helix	546-555	10
α-helix	559-569	11
β-strand	577-579	3	147
α-helix	582-597	16
α-helix	602-612	11
α-helix	619-621	3
α-helix	624-644	21
α-helix	648-655	8
α-helix	665-677	13
α-helix	688-700	13
α-helix	705-718	14
α-helix	727-736	10
α-helix	749-769	21
α-helix	773-781	9
α-helix	783-786	4
α-helix	788-789	2
α-helix	792-795	4
α-helix	798-813	16
α-helix	815-817	3
α-helix	818-826	9
α-helix	832-838	7
α-helix	843-855	13
α-helix	864-866	3
α-helix	871-887	17
α-helix	891-898	8
α-helix	904-906	3
α-helix	909-911	3
α-helix	912-923	12
α-helix	928-953	26
α-helix	964-971	8
β-strand	982-984	3	141
α-helix	985-1001	17
α-helix	1010-1013	4
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1028-1039	12
α-helix	1041-1043	3
α-helix	1055-1063	9
α-helix	1071-1089	19
α-helix	1091	1
β-strand	1092-1098	7	148
β-strand	1107-1113	7	148
α-helix	1119-1120	2
β-strand	1121-1127	7	148
α-helix	1128-1130	3
β-strand	1131-1132	2	149
β-strand	1135-1136	2	149
α-helix	1138-1140	3
β-strand	1141	1	148
α-helix	1142-1144	3
β-strand	1145-1146	2	148
α-helix	1154-1156	3
β-strand	1158-1163	6	150
β-strand	1166-1178	13	150
β-strand	1192-1202	11	150
β-strand	1203	1	151
β-strand	1209	1	151
β-strand	1213-1215	3	150
α-helix	1218-1223	6
α-helix	1230-1232	3
β-strand	1233-1239	7	152
α-helix	1241-1243	3
β-strand	1244-1250	7	152
α-helix	1256-1261	6
β-strand	1265-1269	5	152
β-strand	1275-1277	3	152
α-helix	1278-1279	2
α-helix	1280-1290	11
α-helix	1291-1293	3
β-strand	1296	1	153
β-strand	1299	1	153
β-strand	1300-1301	2	154
β-strand	1303-1304	2	148
β-strand	1310-1311	2	155
β-strand	1316	1	156
β-strand	1321-1324	4	155
α-helix	1326-1328	3
β-strand	1331-1332	2	155
β-strand	1336	1	155
β-strand	1337	1	156
β-strand	1340-1345	6	157
β-strand	1348-1353	6	157
β-strand	1356-1360	5	155
α-helix	1367-1378	12
β-strand	1384-1393	10	158
β-strand	1404-1412	9	158
β-strand	1415-1426	12	158
β-strand	1434-1438	5	158
β-strand	1443-1447	5	158
α-helix	1450-1451	2
β-strand	1454-1458	5	158
α-helix	1464-1467	4
β-strand	1471-1474	4	158
β-strand	1480-1490	11	158
α-helix	1495-1497	3
β-strand	1498-1504	7	155
β-strand	1507-1512	6	155
α-helix	1513-1516	4
α-helix	1520-1523	4
β-strand	1528-1531	4	155
β-strand	1535-1538	4	157
β-strand	1545	1	155
β-strand	1548-1558	11	155
β-strand	1564-1576	13	155
α-helix	1577-1578	2
α-helix	1582-1584	3
β-strand	1585-1589	5	154
β-strand	1593-1598	6	154
β-strand	1601-1604	4	154
α-helix	1609-1617	9
α-helix	1627-1630	4
β-strand	1633-1635	3	159
β-strand	1640-1647	8	160
α-helix	1648-1650	3
α-helix	1652-1655	4
β-strand	1660-1666	7	161
β-strand	1668	1	162
β-strand	1670	1	162
β-strand	1674-1680	7	161
β-strand	1686-1693	8	160
β-strand	1705-1711	7	161
β-strand	1714	1	161
β-strand	1721-1722	2	163
β-strand	1724-1727	4	161
β-strand	1733-1735	3	161
β-strand	1740	1	163
β-strand	1746-1750	5	160
β-strand	1755-1757	3	159
α-helix	1765-1769	5
α-helix	1770-1774	5
α-helix	1775-1785	11
α-helix	1789-1796	8
β-strand	1800	1	164
β-strand	1806-1807	2	165
β-strand	1810-1811	2	165
β-strand	1816	1	164
α-helix	1819-1822	4
α-helix	1831-1833	3
α-helix	1837-1843	7
α-helix	1846-1870	25
α-helix	1873-1890	18
α-helix	1893-1894	2
β-strand	1906	1	140
α-helix	1907-1911	5
α-helix	1913-1921	9
α-helix	1944-1946	3
α-helix	1948	1
β-strand	1949	1	139
α-helix	1950	1
β-strand	1951	1	138
α-helix	1952	1
α-helix	1954-1971	18
β-strand	1974	1	166
β-strand	1980	1	166
α-helix	1988-1992	5
β-strand	2006	1	167
α-helix	2007-2012	6
β-strand	2017	1	168
α-helix	2019-2104	86
α-helix	2109-2122	14
α-helix	2125-2139	15
β-strand	2144-2145	2	32
β-strand	2149-2150	2	32
α-helix	2156-2243	88
α-helix	2248-2283	36
β-strand	2298	1	167
α-helix	2299-2301	3
α-helix	2306-2324	19
α-helix	2328	1
β-strand	2329-2336	8	169
α-helix	2337-2342	6
α-helix	2346-2348	3
α-helix	2353-2362	10
β-strand	2367-2370	4	170
β-strand	2373-2377	5	170
β-strand	2387-2392	6	170
α-helix	2394-2396	3
α-helix	2399-2401	3
α-helix	2404-2406	3
β-strand	2410-2418	9	169
β-strand	2431-2435	5	170
α-helix	2441-2442	2
β-strand	2447-2450	4	170
β-strand	2456	1	169
β-strand	2468	1	168
α-helix	2469-2470	2
β-strand	2476	1	169
β-strand	2481-2486	6	170
α-helix	2491-2493	3
α-helix	2498-2501	4
β-strand	2508-2515	8	169

Chain F: 65 helices, 170 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
α-helix	21-22	2
β-strand	27-29	3	171
β-strand	38-42	5	171
β-strand	56-60	5	171
β-strand	65-66	2	172
β-strand	69-70	2	172
β-strand	72-73	2	171
β-strand	78-81	4	173
β-strand	96-98	3	173
β-strand	102-103	2	173
β-strand	104-106	3	174
β-strand	111-116	6	174
β-strand	119-132	14	174
β-strand	134-135	2	174
β-strand	140-146	7	174
β-strand	149	1	175
β-strand	151	1	175
β-strand	154-158	5	174
β-strand	164-167	4	174
α-helix	171-173	3
β-strand	174-177	4	173
β-strand	180-188	9	173
β-strand	189-193	5	174
β-strand	199-206	8	174
α-helix	214-219	6
β-strand	227-236	10	174
α-helix	250-252	3
α-helix	253-255	3
β-strand	256-263	8	174
α-helix	274-276	3
α-helix	281-283	3
β-strand	290-292	3	176
β-strand	299-301	3	176
β-strand	307-312	6	174
α-helix	314-318	5
β-strand	328-337	10	174
β-strand	346-354	9	174
β-strand	360-362	3	174
α-helix	364-365	2
β-strand	366-370	5	174
α-helix	375-378	4
β-strand	380-383	4	177
α-helix	385-387	3
β-strand	396-399	4	178
β-strand	408-413	6	178
β-strand	416-420	5	178
β-strand	422-424	3	179
β-strand	433-435	3	179
α-helix	436-438	3
β-strand	439-440	2	178
β-strand	444	1	69
β-strand	451-454	4	180
β-strand	462-468	7	180
β-strand	471-478	8	180
β-strand	482-488	7	180
β-strand	492-493	2	35
α-helix	494-497	4
β-strand	502-504	3	181
α-helix	512	1
β-strand	513-517	5	181
β-strand	521-525	5	181
β-strand	527	1	182
β-strand	532	1	182
α-helix	533-535	3
β-strand	536-539	4	181
α-helix	540-541	2
β-strand	556-560	5	183
β-strand	569-573	5	183
β-strand	578-581	4	183
β-strand	583	1	184
β-strand	589	1	184
β-strand	593-595	3	183
α-helix	607-609	3
β-strand	610-613	4	185
α-helix	621	1
β-strand	622-627	6	185
β-strand	630-634	5	185
β-strand	636	1	186
β-strand	642	1	186
α-helix	643-645	3
β-strand	646-649	4	185
α-helix	650-651	2
β-strand	661-665	5	177
β-strand	674-679	6	177
β-strand	685-690	6	177
β-strand	699-703	5	174
β-strand	708-716	9	174
α-helix	717-731	15
β-strand	738	1	174
β-strand	744-753	10	174
β-strand	759-771	13	174
β-strand	778-791	14	174
α-helix	792-793	2
α-helix	801-803	3
β-strand	804-810	7	174
α-helix	815-818	4
α-helix	820-824	5
α-helix	826-827	2
α-helix	831-835	5
β-strand	838-843	6	174
β-strand	846-849	4	174
α-helix	855-863	9
β-strand	869-876	8	174
α-helix	881-884	4
β-strand	888-900	13	174
β-strand	908-920	13	174
β-strand	929-938	10	174
β-strand	944-951	8	174
α-helix	952-956	5
α-helix	970-973	4
α-helix	978-980	3
β-strand	983-996	14	174
β-strand	1001-1016	16	174
α-helix	1018-1020	3
α-helix	1028-1031	4
β-strand	1045-1055	11	174
α-helix	1062-1063	2
β-strand	1071-1080	10	174
α-helix	1082-1086	5
α-helix	1094-1103	10
β-strand	1107-1109	3	174
β-strand	1121-1131	11	174
α-helix	1134-1136	3
β-strand	1140-1146	7	174
β-strand	1152-1156	5	174
β-strand	1163-1167	5	174
β-strand	1173	1	174
β-strand	1175-1179	5	187
β-strand	1184-1189	6	187
β-strand	1195-1200	6	187
β-strand	1206-1214	9	187
β-strand	1219-1221	3	187
α-helix	1236-1240	5
β-strand	1249	1	187
β-strand	1251-1255	5	188
β-strand	1262	1	189
α-helix	1265-1281	17
β-strand	1285	1	190
β-strand	1290	1	189
β-strand	1291	1	190
α-helix	1293-1301	9
α-helix	1307-1315	9
β-strand	1322-1327	6	188
α-helix	1338-1339	2
β-strand	1340-1346	7	188
β-strand	1352-1359	8	188
β-strand	1362-1367	6	188
β-strand	1373-1380	8	188
β-strand	1383-1387	5	188
β-strand	1390-1392	3	191
β-strand	1398-1402	5	191
β-strand	1405-1407	3	188
α-helix	1415-1420	6
β-strand	1426-1431	6	191
β-strand	1437-1441	5	191
β-strand	1447-1452	6	191
β-strand	1456-1460	5	191
α-helix	1462-1465	4
α-helix	1466-1469	4
α-helix	1485-1488	4
β-strand	1493-1497	5	191
β-strand	1503-1510	8	191
β-strand	1519-1528	10	191
β-strand	1532-1537	6	191
α-helix	1539-1545	7
α-helix	1551-1553	3
β-strand	1555-1559	5	191
β-strand	1565-1570	6	191
β-strand	1574-1580	7	191
β-strand	1586-1590	5	191
β-strand	1596-1601	6	191
β-strand	1610-1616	7	191
β-strand	1624-1631	8	191
α-helix	1636-1640	5
β-strand	1647-1651	5	191
β-strand	1655-1662	8	191
β-strand	1668-1675	8	191
β-strand	1676	1	192
α-helix	1689-1693	5
β-strand	1696	1	192
β-strand	1701-1707	7	191
β-strand	1713-1717	5	191
β-strand	1723-1728	6	191
β-strand	1734-1741	8	191
β-strand	1744-1755	12	191
β-strand	1761-1766	6	191
β-strand	1771-1777	7	191
β-strand	1782-1790	9	191
β-strand	1795-1804	10	191
β-strand	1810-1815	6	191
α-helix	1818-1820	3
α-helix	1828-1831	4
β-strand	1832-1833	2	191
β-strand	1834-1836	3	193
β-strand	1842-1850	9	193
α-helix	1861-1863	3
β-strand	1864	1	194
α-helix	1866-1868	3
β-strand	1872-1881	10	193
β-strand	1887-1894	8	193
β-strand	1899-1904	6	193
β-strand	1905-1907	3	195
β-strand	1914-1916	3	195
α-helix	1917-1919	3
α-helix	1923-1926	4
α-helix	1927-1929	3
β-strand	1930	1	196
β-strand	1936	1	196
β-strand	1938-1940	3	197
β-strand	1943-1944	2	197
β-strand	1945-1947	3	194
β-strand	1953-1959	7	194
α-helix	1965-1967	3
β-strand	1968-1974	7	194
β-strand	1980-1989	10	194
β-strand	1992-2001	10	194
β-strand	2004-2011	8	194
β-strand	2014-2024	11	194
β-strand	2032-2039	8	194
β-strand	2049-2055	7	194
β-strand	2061-2065	5	194
β-strand	2071-2078	8	194
β-strand	2082-2088	7	194
α-helix	2091-2094	4
β-strand	2099	1	198
α-helix	2101-2103	3
α-helix	2104	1
β-strand	2105-2106	2	198
α-helix	2111	1
β-strand	2112-2114	3	198
β-strand	2117-2120	4	198
β-strand	2125-2126	2	198
β-strand	2142	1	198
α-helix	2144-2146	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TcdA1	A, B, C, D, E	protein	2516	Photorhabdus luminescens	Q9RN43
TcdB2,TccC3	F	protein	2434	Photorhabdus luminescens	Q8GF97 (AlphaFold model), Q8GF99

Sequence of entity 1 (A, B, C, D, E), FASTA

>6H6E_1 TcdA1 (chains A, B, C, D, E)
MNESVKEIPDVLKSQCGFNCLTDISHSSFNEFRQQVSEHLSWSETHDLYHDAQQAQKDNR
LYEARILKRANPQLQNAVHLAILAPNAELIGYNNQFSGRASQYVAPGTVSSMFSPAAYLT
ELYREARNLHASDSVYYLDTRRPDLKSMALSQQNMDIELSTLSLSNELLLESIKTESKLE
NYTKVMEMLSTFRPSGATPYHDAYENVREVIQLQDPGLEQLNASPAIAGLMHQASLLGIN
ASISPELFNILTEEITEGNAEELYKKNFGNIEPASLAMPEYLKRYYNLSDEELSQFIGKA
SNFGQQEYSNNQLITPVVNSSDGTVKVYRITREYTTNAYQMDVELFPFGGENYRLDYKFK
NFYNASYLSIKLNDKRELVRTEGAPQVNIEYSANITLNTADISQPFEIGLTRVLPSGSWA
YAAAKFTVEEYNQYSFLLKLNKAIRLSRATELSPTILEGIVRSVNLQLDINTDVLGKVFL
TKYYMQRYAIHAETALILCNAPISQRSYDNQPSQFDRLFNTPLLNGQYFSTGDEEIDLNS
GSTGDWRKTILKRAFNIDDVSLFRLLKITDHDNKDGKIKNNLKNLSNLYIGKLLADIHQL
TIDELDLLLIAVGEGKTNLSAISDKQLATLIRKLNTITSWLHTQKWSVFQLFIMTSTSYN
KTLTPEIKNLLDTVYHGLQGFDKDKADLLHVMAPYIAATLQLSSENVAHSVLLWADKLQP
GDGAMTAEKFWDWLNTKYTPGSSEAVETQEHIVQYCQALAQLEMVYHSTGINENAFRLFV
TKPEMFGAATGAAPAHDALSLIMLTRFADWVNALGEKASSVLAAFEANSLTAEQLADAMN
LDANLLLQASIQAQNHQHLPPVTPENAFSCWTSINTILQWVNVAQQLNVAPQGVSALVGL
DYIQSMKETPTYAQWENAAGVLTAGLNSQQANTLHAFLDESRSAALSTYYIRQVAKAAAA
IKSRDDLYQYLLIDNQVSAAIKTTRIAEAIASIQLYVNRALENVEENANSGVISRQFFID
WDKYNKRYSTWAGVSQLVYYPENYIDPTMRIGQTKMMDALLQSVSQSQLNADTVEDAFMS
YLTSFEQVANLKVISAYHDNINNDQGLTYFIGLSETDAGEYYWRSVDHSKFNDGKFAANA
WSEWHKIDCPINPYKSTIRPVIYKSRLYLLWLEQKEITKQTGNSKDGYQTETDYRYELKL
AHIRYDGTWNTPITFDVNKKISELKLEKNRAPGLYCAGYQGEDTLLVMFYNQQDTLDSYK
NASMQGLYIFADMASKDMTPEQSNVYRDNSYQQFDTNNVRRVNNRYAEDYEIPSSVSSRK
DYGWGDYYLSMVYNGDIPTINYKAASSDLKIYISPKLRIIHNGYEGQKRNQCNLMNKYGK
LGDKFIVYTSLGVNPNNSSNKLMFYPVYQYSGNTSGLNQGRLLFHRDTTYPSKVEAWIPG
AKRSLTNQNAAIGDDYATDSLNKPDDLKQYIFMTDSKGTATDVSGPVEINTAISPAKVQI
IVKAGGKEQTFTADKDVSIQPSPSFDEMNYQFNALEIDGSGLNFINNSASIDVTFTAFAE
DGRKLGYESFSIPVTLKVSTDNALTLHHNENGAQYMQWQSYRTRLNTLFARQLVARATTG
IDTILSMETQNIQEPQLGKGFYATFVIPPYNLSTHGDERWFKLYIKHVVDNNSHIIYSGQ
LTDTNINITLFIPLDDVPLNQDYHAKVYMTFKKSPSDGTWWGPHFVRDDKGIVTINPKSI
LTHFESVNVLNNISSEPMDFSGANSLYFWELFYYTPMLVAQRLLHEQNFDEANRWLKYVW
SPSGYIVHGQIQNYQWNVRPLLEDTSWNSDPLDSVDPDAVAQHDPMHYKVSTFMRTLDLL
IARGDHAYRQLERDTLNEAKMWYMQALHLLGDKPYLPLSTTWSDPRLDRAADITTQNAHD
SAIVALRQNIPTPAPLSLRSANTLTDLFLPQINEVMMNYWQTLAQRVYNLRHNLSIDGQP
LYLPIYATPADPKALLSAAVATSQGGGKLPESFMSLWRFPHMLENARGMVSQLTQFGSTL
QNIIERQDAEALNALLQNQAAELILTNLSIQDKTIEELDAEKTVLEKSKAGAQSRFDSYG
KLYDENINAGENQAMTLRASAAGLTTAVQASRLAGAAADLVPNIFGFAGGGSRWGAIAEA
TGYVMEFSANVMNTEADKISQSETYRRRRQEWEIQRNNAEAELKQIDAQLKSLAVRREAA
VLQKTSLKTQQEQTQSQLAFLQRKFSNQALYNWLRGRLAAIYFQFYDLAVARCLMAEQAY
RWELNDDSARFIKPGAWQGTYAGLLAGETLMLSLAQMEDAHLKRDKRALEVERTVSLAEV
YAGLPKDNGPFSLAQEIDKLVSQGSGSAGSGNNNLAFGAGTDTKTSLQASVSFADLKIRE
DYPASLGKIRRIKQISVTLPALLGPYQDVQAILSYGDKAGLANGCEALAVSHGMNDSGQF
QLDFNDGKFLPFEGIAIDQGTLTLSFPNASMPEKGKQATMLKTLNDIILHIRYTIK

Sequence of entity 2 (F), FASTA

>6H6E_2 TcdB2,TccC3 (chains F)
MQNSQDFSITELSLPKGGGAITGMGEALTPTGPDGMAALSLPLPISAGRGYAPAFTLNYN
SGAGNSPFGLGWDCNVMTIRRRTHFGVPHYDETDTFLGPEGEVLVVADQPRDESTLQGIN
LGATFTVTGYRSRLESHFSRLEYWQPKTTGKTDFWLIYSPDGQVHLLGKSPQARISNPSQ
TTQTAQWLLEASVSSRGEQIYYQYRAEDDTGCEADEITHHLQATAQRYLHIVYYGNRTAS
ETLPGLDGSAPSQADWLFYLVFDYGERSNNLKTPPAFSTTGSWLCRQDRFSRYEYGFEIR
TRRLCRQVLMYHHLQALDSKITEHNGPTLVSRLILNYDESAIASTLVFVRRVGHEQDGNV
VTLPPLELAYQDFSPRHHAHWQPMDVLANFNAIQRWQLVDLKGEGLPGLLYQDKGAWWYR
SAQRLGEIGSDAVTWEKMQPLSVIPSLQSNASLVDINGDGQLDWVITGPGLRGYHSQRPD
GSWTRFTPLNALPVEYTHPRAQLADLMGAGLSDLVLIGPKSVRLYANTRDGFAKGKDVVQ
SGDITLPVPGADPRKLVAFSDVLGSGQAHLVEVSATKVTCWPNLGRGRFGQPITLPGFSQ
PATEFNPAQVYLADLDGSGPTDLIYVHTNRLDIFLNKSGNGFAEPVTLRFPEGLRFDHTC
QLQMADVQGLGVASLILSVPHMSPHHWRCDLTNMKPWLLNEMNNNMGVHHTLRYRSSSQF
WLDEKAAALTTGQTPVCYLPFPIHTLWQTETEDEISGNKLVTTLRYARGAWDGREREFRG
FGYVEQTDSHQLAQGNAPERTPPALTKNWYATGLPVIDNALSTEYWRDDQAFAGFSPRFT
TWQDNKDVPLTPEDDNSRYWFNRALKGQLLRSELYGLDDSTNKHVPYTVTEFRSQVRRLQ
HTDSRYPVLWSSVVESRNYHYERIASDPQCSQNITLSSDRFGQPLKQLSVQYPRRQQPAI
NLYPDTLPDKLLANSYDDQQRQLRLTYQQSSWHHLTNNTVRVLGLPDSTRSDIFTYGAEN
VPAGGLNLELLSDKNSLIADDKPREYLGQQKTAYTDGQNTTPLQTPTRQALIAFTETTVF
NQSTLSAFNGSIPSDKLSTTLEQAGYQQTNYLFPRTGEDKVWVAHHGYTDYGTAAQFWRP
QKQSNTQLTGKITLIWDANYCVVVQTRDAAGLTTSAKYDWRFLTPVQLTDINDNQHLITL
DALGRPITLRFWGTENGKMTGYSSPEKASFSPPSDVNAAIELKKPLPVAQCQVYAPESWM
PVLSQKTFNRLAEQDWQKLYNARIITEDGRICTLAYRRWVQSQKAIPQLISLLNNGPRLP
PHSLTLTTDRYDHDPEQQIRQQVVFSDGFGRLLQAAARHEAGMARQRNEDGSLIINVQHT
ENRWAVTGRTEYDNKGQPIRTYQPYFLNDWRYVSNDSARQEKEAYADTHVYDPIGREIKV
ITAKGWFRRTLFTPWFTVNEDENDTAAEVKKVKMMKNIDPKLYQKTPTVSVYDNRGLIIR
NIDFHRTTANGDPDTRITRHQYDIHGHLNQSIDPRLYEAKQTNNTIKPNFLWQYDLTGNP
LCTESIDAGRTVTLNDIEGRPLLTVTATGVIQTRQYETSSLPGRLLSVAEQTPEEKTSRI
TERLIWAGNTEAEKDHNLAGQCVRHYDTAGVTRLESLSLTGTVLSQSSQLLIDTQEANWT
GDNETVWQNMLADDIYTTLSTFDATGALLTQTDAKGNIQRLAYDVAGQLNGSWLTLKGQT
EQVIIKSLTYSAAGQKLREEHGNDVITEYSYEPETQRLIGIKTRRPSDTKVLQDLRYEYD
PVGNVISIRNDAEATRFWHNQKVMPENTYTYDSLYQLISATGREMANIGQQSHQFPSPAL
PSDNNTYTNYTRTYTYDRGGNLTKIQHSSPATQNNYTTNITVSNRSNRAVLSTLTEDPAQ
VDALFDAGGHQNTLISGQNLNWNTRGELQQVTLVKRDKGANDDREWYRYSGDGRRMLKIN
EQQASNNAQTQRVTYLPNLELRLTQNSTATTEDLQVITVGEAGRAQVRVLHWESGKPEDI
DNNQLRYSYDNLIGSSQLELDSEGQIISEEEYYPYGGTALWAARNQTEASYKTIRYSGKE
RDATGLYYYGYRYYQPWIGRWLSSDPAGTIDGLNLYRMVRNNPVTLLDPDGLMPTIAERI
AALKKNKVTDSAPSPANATNVAINIRPPVAPKPSLPKASTSSQPTTHPIGAANIKPTTSG
SSIVAPLSPVGNKSTSEISLPESAQSSSSSTTSTNLQKKSFTLYRADNRSFEEMQSKFPE
GFKAWTPLDTKMARQFASIFIGQKDTSNLPKETVKNISTWGAKPKLKDLSNYIKYTKDKS
TVWVSTAINTEAGGQSSGAPLHKIDMDLYEFAIDGQKLNPLPEGRTKNMVPSLLLDTPQI
ETSSIIALNHGPVNDAEISFLTTIPLKNVKPHKR

Primary citation

Tc toxin activation requires unfolding and refolding of a beta-propeller. Gatsogiannis, C., Merino, F., Roderer, D. et al. Nature (2018) 563:209-213. DOI 10.1038/s41586-018-0556-6 · PubMed

Other PDB entries of the same protein (UniProt Q9RN43), best resolution first:

6RW6 2.75 Å, Cryo-EM structure of Photorhabdus luminescens TcdA1
6L7I 2.9 Å, Signal substraction of TcdB1-TccC2 and part of TcdA1
8CPZ 2.9 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K1179W mutant
6L7E 3.2 Å, Toxin Complex TcdA1-TcdB1-TccC2
8CQ0 3.2 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, K567W K2008W mutant
6SUE 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore, Mutation TccC3-D651A
6SUF 3.4 Å, Structure of Photorhabdus luminescens Tc holotoxin pore
5LKH 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state (obtained by flexible fitting)
5LKI 3.46 Å, Cryo-EM structure of the Tc toxin TcdA1 in its pore state
4O9Y 3.5 Å, Crystal Structure of TcdA1
8CQ2 3.6 Å, Photorhabdus luminescens TcdA1 prepore-to-pore intermediate, C16S, C20S, C870S, T1279C…
6H6F 3.72 Å, PTC3 holotoxin complex from Photorhabdus luminiscens - Mutant TcC-D651A

Browse structure collections

About this viewer

MolViewer shows 6H6E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.