4P0B: HOIP PUB domain

Crystal structure of HOIP PUB domain in complex with OTULIN PIM. Determined by X-ray diffraction at 2.7 Å resolution. Released 7 May 2014.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,826
Mol. weight: 44 kDa
Released: 7 May 2014

Explore 4P0B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P0B contains 20 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	7-23	17
α-helix	35-38	4
α-helix	44-46	3
α-helix	53-58	6
α-helix	65-86	22
β-strand	97	1	1
α-helix	103-108	6
α-helix	109-111	3
α-helix	116-122	7
β-strand	126	1	1
β-strand	133	1	1
α-helix	143-164	22
α-helix	171-174	4

Chain C: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	7-23	17
α-helix	35-38	4
α-helix	44-46	3
α-helix	53-58	6
α-helix	68-87	20
β-strand	97-98	2	2
α-helix	103-107	5
α-helix	109-111	3
α-helix	115-122	8
β-strand	126-127	2	2
β-strand	132-133	2	2
α-helix	143-164	22
α-helix	171-174	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RNF31	A, C	protein	184	Homo sapiens	Q96EP0 (AlphaFold model)
Ubiquitin thioesterase otulin	B, D	protein	10	Homo sapiens	Q96BN8 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4P0B_1 E3 ubiquitin-protein ligase RNF31 (chains A, C)
GPLGSMPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAAR
LVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGG
RDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALE
QLLE

Sequence of entity 2 (B, D), FASTA

>4P0B_2 Ubiquitin thioesterase otulin (chains B, D)
EEDMYRAADE

Primary citation

Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling. Schaeffer, V., Akutsu, M., Olma, M.H. et al. Mol Cell (2014) 54:349-361. DOI 10.1016/j.molcel.2014.03.016 · PubMed

Other PDB entries of the same protein (UniProt Q96EP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KC5 1.54 Å, HOIP-HOIPIN1 complex
4LJO 1.56 Å, Structure of an active ligase (HOIP)/ubiquitin transfer complex
7V8F 1.66 Å, Crystal structure of UBE2L3 bound to HOIP RING1 domain.
4P09 1.7 Å, Crystal structure of HOIP PUB domain
9B0B 1.7 Å, Structure of Optineurin bound to HOIP NZF1 domain
9B12 1.81 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
4OWF 2.0 Å, Crystal structure of the NEMO CoZi in complex with HOIP NZF1 domain
4OYK 2.0 Å, Structure of HOIP PUB domain bound to OTULIN PIM
6SC5 2.1 Å, dAb3/HOIP-RBR-Ligand2
6SC8 2.11 Å, dAb3/HOIP-RBR-Ligand4
6KC6 2.12 Å, HOIP-HOIPIN8 complex
4LJP 2.15 Å, Structure of an active ligase (HOIP-H889A)/ubiquitin transfer complex

Browse structure collections

About this viewer

MolViewer shows 4P0B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.