Crystal structure of the mouse C5a anaphylatoxin. Determined by X-ray diffraction at 1.4 Å resolution. Released 11 Jun 2014.
Explore 4P3A in 3D Show helices and sheets RCSB PDB PDBe
4P3A contains 16 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 680-691 | 12 | |
| α-helix | 697-707 | 11 | |
| α-helix | 715-719 | 5 | |
| α-helix | 726-744 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 680-691 | 12 | |
| α-helix | 697-706 | 10 | |
| α-helix | 715-719 | 5 | |
| α-helix | 726-744 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Complement C5 | A, B, C, D | protein | 79 | Mus musculus | P06684 (AlphaFold model) |
>4P3A_1 Complement C5 (chains A, B, C, D) GANLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECC TIANKIRKESPHKPVQLGR
Structural and functional characterization of human and murine C5a anaphylatoxins. Schatz-Jakobsen, J.A., Yatime, L., Larsen, C. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:1704-1717. DOI 10.1107/S139900471400844X · PubMed
Other PDB entries of the same protein (UniProt P06684 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4P3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.