Crystal structure of the mirror-image L-RNA/L-DNA aptamer NOX-D20 in complex with mouse C5a complement anaphylatoxin. Determined by X-ray diffraction at 1.8 Å resolution. Released 6 May 2015.
Explore 4WB2 in 3D Show helices and sheets RCSB PDB PDBe
4WB2 contains 12 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 680-691 | 12 | |
| α-helix | 697-707 | 11 | |
| α-helix | 715-719 | 5 | |
| α-helix | 726-744 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 682-691 | 10 | |
| α-helix | 697-707 | 11 | |
| α-helix | 715-719 | 5 | |
| α-helix | 726-744 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 680-691 | 12 | |
| α-helix | 697-706 | 10 | |
| α-helix | 715-719 | 5 | |
| α-helix | 726-744 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Complement C5 | A, B, C | protein | 79 | Mus musculus | P06684 (AlphaFold model) |
| mixed L-RNA/L-DNA mirror-image aptamer NOX-D20 (40-MER) | D, E | DNA | 40 | synthetic construct |
>4WB2_1 Complement C5 (chains A, B, C) GANLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECC TIANKIRKESPHKPVQLGR
>4WB2_2 mixed L-RNA/L-DNA mirror-image aptamer NOX-D20 (40-MER) (chains D, E) GCGXUGXGGUGGUGAXGGGUUGUUGGGXGXCGXCGCXCGC
Water and common crystallization additives (ACT) are not listed.
Structural basis for the targeting of complement anaphylatoxin C5a using a mixed L-RNA/L-DNA aptamer. Yatime, L., Maasch, C., Hoehlig, K. et al. Nat Commun (2015) 6:6481-6481. DOI 10.1038/ncomms7481 · PubMed
Other PDB entries of the same protein (UniProt P06684 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WB2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.