4P3B: Mouse C5a-desArg anaphylatoxin

Crystal structure of the mouse C5a-desArg anaphylatoxin. Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Jun 2014.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Mus musculus
Chains: 4
Atoms: 2,461
Mol. weight: 36.25 kDa
Released: 11 Jun 2014

Explore 4P3B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P3B contains 16 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	680-691	12
α-helix	697-706	10
α-helix	715-719	5
α-helix	726-744	19

Chains B and C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	680-692	13
α-helix	697-706	10
α-helix	715-719	5
α-helix	726-744	19

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	680-691	12
α-helix	697-707	11
α-helix	715-719	5
α-helix	726-744	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5	A, B, C, D	protein	78	Mus musculus	P06684 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4P3B_1 Complement C5 (chains A, B, C, D)
GANLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECC
TIANKIRKESPHKPVQLG

Primary citation

Structural and functional characterization of human and murine C5a anaphylatoxins. Schatz-Jakobsen, J.A., Yatime, L., Larsen, C. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:1704-1717. DOI 10.1107/S139900471400844X · PubMed

Other PDB entries of the same protein (UniProt P06684 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4P3A 1.4 Å, Crystal structure of the mouse C5a anaphylatoxin
4WB2 1.8 Å, Crystal structure of the mirror-image L-RNA/L-DNA aptamer NOX-D20 in complex with mouse…
4WB3 2.0 Å, Crystal structure of the mirror-image L-RNA/L-DNA aptamer NOX-D20 in complex with mouse…
9KWX 3.13 Å, Structure of mouse C5a-desArg bound mouse C5aR1 in complex with Go
9KWG 3.15 Å, Structure of mouse C5a bound mouse C5aR1 in complex with Go
9WDI 3.33 Å, Structure of mC5aR2 in complex with mC5a-desArg
25IF 3.42 Å, Structure of mC5aR2 in complex with mC5a-desArg (Monomer)
8JZP 3.45 Å, Structure of mouse C5a-human C5aR1-Go complex

Browse structure collections

About this viewer

MolViewer shows 4P3B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.