4P9V: Grb2 SH2

Grb2 SH2 complexed with a pTyr-Ac6cN-Asn tripeptide. Determined by X-ray diffraction at 1.64 Å resolution. Released 18 Jun 2014.

Method: X-ray diffraction
Resolution: 1.64 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 923
Mol. weight: 14.45 kDa
Released: 18 Jun 2014

Explore 4P9V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P9V contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	61	1	1
α-helix	67-75	9
β-strand	82	1	2
β-strand	83-87	5	1
β-strand	95-101	7	1
β-strand	104-109	6	1
β-strand	111-112	2	3
β-strand	118-119	2	3
β-strand	124-125	2	3
α-helix	128-134	7
β-strand	149	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Growth factor receptor-bound protein 2	A	protein	117	Homo sapiens	P62993 (AlphaFold model)
Phq-ptr-02K-asn-NH2	B	protein	5	synthetic construct

Sequence of entity 1 (A), FASTA

>4P9V_1 Growth factor receptor-bound protein 2 (chains A)
IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLR
DGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH

Sequence of entity 2 (B), FASTA

>4P9V_2 PHQ-PTR-02K-ASN-NH2 (chains B)
XYANX

Primary citation

Protein-ligand interactions: Probing the energetics of a putative cation-pi interaction. Myslinski, J.M., Clements, J.H., Martin, S.F. Bioorg Med Chem Lett (2014) 24:3164-3167. DOI 10.1016/j.bmcl.2014.04.114 · PubMed

Other PDB entries of the same protein (UniProt P62993 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ICG 1.15 Å, Grb2 SH2 domain in phosphopeptide free form
3WA4 1.35 Å, Grb2 SH2 domain/CD28-derived peptide complex
1JYR 1.55 Å, Xray Structure of Grb2 SH2 Domain Complexed with a Phosphorylated Peptide
2VWF 1.58 Å, Grb2 SH3C (2)
2VVK 1.6 Å, Grb2 SH3C (1)
3OV1 1.6 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide
1GCQ 1.68 Å, Crystal structure of vav and GRB2 SH3 domains
2W0Z 1.7 Å, Grb2 SH3C (3)
3C7I 1.7 Å, X-RAY crystal structure of the complex between the grb2-sh2 domain and a flexible…
3IN8 1.7 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a Flexible Ac-pTyr-Ile-Asn-NH2…
3S8L 1.71 Å, Protein-Ligand Interactions: Thermodynamic Effects Associated with Increasing…
3S8N 1.71 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide

Browse structure collections

About this viewer

MolViewer shows 4P9V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.