4PFK: Phosphofructokinase. Structure and control

Phosphofructokinase. Structure and control. Determined by X-ray diffraction at 2.4 Å resolution. Released 9 Jan 1989.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Geobacillus stearothermophilus
Chains: 1
Atoms: 2,534
Mol. weight: 35.33 kDa
Ligands: F6P, MG, ADP
Released: 9 Jan 1989

Explore 4PFK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PFK contains 14 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	16-29	14
β-strand	33-37	5	1
α-helix	40-45	6
β-strand	49-52	4	1
α-helix	54-57	4
α-helix	79-92	14
β-strand	96-101	6	1
α-helix	103-114	12
β-strand	119-123	5	1
β-strand	124	1	2
β-strand	137	1	2
α-helix	139-159	21
β-strand	163-168	6	3
α-helix	175-183	9
β-strand	188-190	3	3
α-helix	198-210	13
β-strand	216-221	6	3
α-helix	227-238	12
β-strand	242-246	5	3
α-helix	248-252	5
α-helix	255-257	3
α-helix	258-276	19
β-strand	282-287	6	1
β-strand	290-295	6	1
α-helix	296-299	4
α-helix	309-318	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphofructokinase	A	protein	319	Geobacillus stearothermophilus	P00512 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4PFK_1 PHOSPHOFRUCTOKINASE (chains A)
MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIQGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQRMYALSKELSI

Ligands and cofactors

ID	Name	Formula	Copies
F6P	6-O-phosphono-beta-D-fructofuranose	C6 H13 O9 P	1
MG	Magnesium ion	Mg	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Phosphofructokinase: structure and control. Evans, P.R., Farrants, G.W., Hudson, P.J. Philos Trans R Soc London,ser B (1981) 293:53-62. PubMed

Other PDB entries of the same protein (UniProt P00512 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4I7E 2.0 Å, Crystal Structure of the Bacillus stearothermophilus Phosphofructokinase Mutant D12A in…
4I36 2.3 Å, Crystal Structure of the Bacillus stearothermophilus Phosphofructokinase Mutant D12A
3PFK 2.4 Å, Phosphofructokinase. Structure and control
4I4I 2.49 Å, Crystal Structure of Bacillus stearothermophilus Phosphofructokinase mutant T156A bound…
6PFK 2.6 Å, Phosphofructokinase, inhibited T-state
3U39 2.79 Å, Crystal Structure of the apo Bacillus Stearothermophilus phosphofructokinase
1MTO 3.2 Å, Crystal structure of a Phosphofructokinase mutant from Bacillus stearothermophilus bound…

Browse more

4PFK is part of these collections:

Metabolism and cellular energy

About this viewer

MolViewer shows 4PFK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.