The longer crystal structure of the grow factor like domain from Beta amypoid precusor protein (APP22-126). Determined by X-ray diffraction at 1.33 Å resolution. Released 8 Apr 2015.
Explore 4PQD in 3D Show helices and sheets RCSB PDB PDBe
4PQD contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-28 | 3 | |
| α-helix | 30-32 | 3 | |
| β-strand | 33-35 | 3 | 1 |
| β-strand | 43-45 | 3 | 1 |
| β-strand | 52-54 | 3 | 1 |
| α-helix | 66-76 | 11 | |
| β-strand | 82-87 | 6 | 1 |
| β-strand | 92-94 | 3 | 2 |
| β-strand | 97-99 | 3 | 3 |
| β-strand | 103-106 | 4 | 3 |
| β-strand | 110-112 | 3 | 2 |
| β-strand | 115-119 | 5 | 1 |
| α-helix | 120 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Amyloid beta A4 protein | A | protein | 105 | Homo sapiens | P05067 (AlphaFold model) |
>4PQD_1 Amyloid beta A4 protein (chains A) TDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQ ITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDA
Mapping the interaction betwwen APP and DR6. Tan, X., Li, W., Wang, Z. To be published.
Other PDB entries of the same protein (UniProt P05067 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4PQD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.