4PWQ: E1-domain of the amyloid precursor protein

High-resolution crystal structure of the E1-domain of the amyloid precursor protein. Determined by X-ray diffraction at 1.4 Å resolution. Released 4 Feb 2015.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,141
Mol. weight: 43.52 kDa
Released: 4 Feb 2015

Explore 4PWQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PWQ contains 9 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	33-35	3	4
α-helix	41-42	2
β-strand	43-45	3	4
β-strand	52-54	3	4
α-helix	66-76	11
β-strand	82-87	6	4
β-strand	92-94	3	5
α-helix	97-98	2
β-strand	99	1	6
β-strand	103	1	6
β-strand	110-112	3	5
α-helix	113-114	2
β-strand	115-119	5	4
β-strand	134-139	6	7
β-strand	145-146	2	7
α-helix	147-159	13
β-strand	163-175	13	7
β-strand	178-188	11	7

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	33-35	3	1
α-helix	41-42	2
β-strand	43-46	4	1
β-strand	51-54	4	1
α-helix	55	1
α-helix	66-76	11
β-strand	82-87	6	1
β-strand	92-94	3	2
β-strand	110-112	3	2
β-strand	115-119	5	1
β-strand	134-139	6	3
β-strand	145-146	2	3
α-helix	147-160	14
β-strand	163-175	13	3
β-strand	178-188	11	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid beta A4 protein	A, B	protein	191	Homo sapiens	P05067 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4PWQ_1 Amyloid beta A4 protein (chains A, B)
MLEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEV
YPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFL
HQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAIEGRKL
AAALEHHHHHH

Primary citation

The Amyloid Precursor Protein Shows a pH-Dependent Conformational Switch in Its E1 Domain. Hoefgen, S., Dahms, S.O., Oertwig, K. et al. J Mol Biol (2015) 427:433-442. DOI 10.1016/j.jmb.2014.12.005 · PubMed

Other PDB entries of the same protein (UniProt P05067 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FMA 0.85 Å, Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain in…
6NB9 1.05 Å, Amyloid-Beta (20-34) with L-isoaspartate 23
6OIZ 1.1 Å, Amyloid-Beta (20-34) wild type
8T82 1.1 Å, Racemic mixture of amyloid beta segment 35-MVGGVV-40 forms heterochiral rippled…
5ONQ 1.17 Å, Alzheimer's Amyloid-Beta Peptide Fragment 29-40 in Complex with Cd-substituted Thermolysin
3JQL 1.2 Å, Crystal Structure of the Complex Formed Between Phospholipase A2 and a Hexapeptide…
3PZZ 1.29 Å, Structure of an amyloid forming peptide GAIIGL (29-34) from amyloid beta
4PQD 1.33 Å, The longer crystal structure of the grow factor like domain from Beta amypoid precusor…
5ONP 1.34 Å, Alzheimer's Amyloid-Beta Peptide Fragment 1-40 in Complex with Cd-substituted Thermolysin
5ONR 1.39 Å, Alzheimer's Amyloid-Beta Peptide Fragment 1-40 in Complex with Thermolysin
7OW1 1.4 Å, Crystal Structure of TAP01 in complex with amyloid beta peptide
6O4J 1.4 Å, Amyloid Beta KLVFFAENVGS 16-26 D23N Iowa mutation

Browse structure collections

About this viewer

MolViewer shows 4PWQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.