4PZ3: CD44 antigen

High-resolution crystal structure of the human CD44 hyaluronan binding domain complex with undefined peptides. Determined by X-ray diffraction at 1.08 Å resolution. Released 17 Sept 2014.

Method: X-ray diffraction
Resolution: 1.08 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 3
Atoms: 2,956
Mol. weight: 34.68 kDa
Released: 17 Sept 2014

Explore 4PZ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PZ3 contains 15 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	21-26	6	1
α-helix	27-28	2
β-strand	29-30	2	1
β-strand	33-38	6	1
β-strand	44	1	2
α-helix	46-55	10
β-strand	59	1	1
α-helix	60-62	3
α-helix	63-71	9
β-strand	80-82	3	1
β-strand	85-90	6	1
β-strand	94	1	3
β-strand	97	1	3
α-helix	98-100	3
β-strand	103-106	4	1
α-helix	107	1
β-strand	114	1	2
β-strand	115-119	5	1
β-strand	127-128	2	1
α-helix	130-132	3
β-strand	139-148	10	1
β-strand	154-160	7	1
α-helix	165-168	4

Chain B: 7 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	21-26	6	4
α-helix	27-28	2
β-strand	29-30	2	4
β-strand	33-38	6	4
β-strand	44	1	5
α-helix	46-55	10
β-strand	59	1	4
α-helix	60-62	3
α-helix	63-71	9
β-strand	80-82	3	4
β-strand	85-90	6	4
β-strand	94	1	6
β-strand	97	1	6
β-strand	103-106	4	4
α-helix	107	1
β-strand	114	1	5
β-strand	115-119	5	4
β-strand	127-128	2	4
α-helix	130-132	3
β-strand	139-148	10	4
β-strand	154-160	7	4
α-helix	165-168	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD44 antigen	A, B	protein	153	Homo sapiens	P16070 (AlphaFold model)
Undefined peptides modeled as AAAV	C	protein	4	Escherichia coli

Sequence of entity 1 (A, B), FASTA

>4PZ3_1 CD44 antigen (chains A, B)
AMAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETC
RYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPN
AFDGPITITIVNRDGTRYVQKGEYRTNPEDIYP

Sequence of entity 2 (C), FASTA

>4PZ3_2 Undefined peptides modeled as AAAV (chains C)
AAAV

Primary citation

High-resolution crystal structures of alternate forms of the human CD44 hyaluronan-binding domain reveal a site for protein interaction. Liu, L.K., Finzel, B. Acta Crystallogr Sect F Struct Biol Cryst Commun (2014) 70:1155-1161. DOI 10.1107/S2053230X14015532 · PubMed

Other PDB entries of the same protein (UniProt P16070 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PZ4 1.6 Å, High-resolution crystal structure of the human CD44 hyaluronan binding domain in new…
32NZ 1.8 Å, An activating H90 ScFv bound to the hyaluronan-binding domain of human CD44
1UUH 2.2 Å, Hyaluronan binding domain of human CD44
6TXS 2.2 Å, The structure of the FERM domain and helical linker of human moesin bound to a CD44…
1POZ Solution structure of the hyaluronan binding domain of human CD44
2I83 hyaluronan-binding domain of CD44 in its ligand-bound form

Browse structure collections

About this viewer

MolViewer shows 4PZ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.