Crystal Structure of tudor domain of SMN1 in complex with a small organic molecule. Determined by X-ray diffraction at 1.75 Å resolution. Released 6 Aug 2014.
Explore 4QQ6 in 3D Show helices and sheets RCSB PDB PDBe
4QQ6 contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 97-101 | 5 | 1 |
| β-strand | 108-117 | 10 | 1 |
| β-strand | 122-127 | 6 | 1 |
| β-strand | 133-137 | 5 | 1 |
| α-helix | 138-140 | 3 | |
| β-strand | 142 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Survival motor neuron protein | A | protein | 67 | Homo sapiens | Q16637 (AlphaFold model) |
>4QQ6_1 Survival motor neuron protein (chains A) GKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSD LLSPICE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 36X | 4-methyl-2,3,4,5,6,7-hexahydrodicyclopenta[b,e]pyridin-8(1H)-imine | C12 H16 N2 | 1 |
Water and common crystallization additives (UNX) are not listed.
A small molecule antagonist of SMN disrupts the interaction between SMN and RNAP II. Liu, Y., Iqbal, A., Li, W. et al. Nat Commun (2022) 13:5453-5453. DOI 10.1038/s41467-022-33229-5 · PubMed
Other PDB entries of the same protein (UniProt Q16637 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4QQ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.