7W30: Tudor domain of SMN

Tudor domain of SMN in complex with a small molecule. Determined by X-ray diffraction at 1.8 Å resolution. Released 5 Oct 2022.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,031
Mol. weight: 30.1 kDa
Ligands: 8AT
Released: 5 Oct 2022

Explore 7W30 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7W30 contains 9 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	91-92	2
β-strand	97-101	5	1
β-strand	108-117	10	1
β-strand	122-127	6	1
β-strand	133-137	5	1
α-helix	138-140	3
β-strand	142	1	1
α-helix	143-144	2

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	97-101	5	2
β-strand	108-117	10	2
β-strand	122-127	6	2
β-strand	133-137	5	2
α-helix	138-140	3
β-strand	142	1	2
α-helix	143-144	2
β-strand	145	1	3
α-helix	146	1

Chain C: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	97-102	6	3
β-strand	107-117	11	3
β-strand	122-127	6	3
β-strand	133-137	5	3
α-helix	138-140	3
β-strand	142	1	3
α-helix	143-144	2
β-strand	145	1	2

Chain D: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	97-101	5	4
β-strand	108-117	10	4
β-strand	122-127	6	4
β-strand	133-137	5	4
α-helix	138-140	3
β-strand	142	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Survival motor neuron protein	A, B, C, D	protein	66	Homo sapiens	Q16637 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7W30_1 Survival motor neuron protein (chains A, B, C, D)
KKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDL
LSPICE

Ligands and cofactors

ID	Name	Formula	Copies
8AT	1,2-dimethylquinolin-4-imine	C11 H12 N2	4

Water and common crystallization additives (UNX) are not listed.

Primary citation

A small molecule antagonist of SMN disrupts the interaction between SMN and RNAP II. Liu, Y., Iqbal, A., Li, W. et al. Nat Commun (2022) 13:5453-5453. DOI 10.1038/s41467-022-33229-5 · PubMed

Other PDB entries of the same protein (UniProt Q16637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7W2P 1.15 Å, Tudor domain of SMN in complex with a small molecule
4QQ6 1.75 Å, Crystal Structure of tudor domain of SMN1 in complex with a small organic molecule
1MHN 1.8 Å, High resolution crystal structure of the SMN Tudor domain
4GLI 1.9 Å, Crystal Structure of Human SMN YG-Dimer
5XJL 2.5 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…
5XJU 2.58 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…
5XJT 2.92 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…
5XJR 3.12 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…
5XJQ 3.28 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…
5XJS 3.38 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…
1G5V Solution structure of the tudor domain of the human smn protein
2LEH Solution structure of the core SMN-Gemin2 complex

Browse structure collections

About this viewer

MolViewer shows 7W30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.