4QUF: Chromodomain of Rhino with H3K9me3

crystal structure of chromodomain of Rhino with H3K9me3. Determined by X-ray diffraction at 2.5 Å resolution. Released 20 Aug 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Drosophila melanogaster
Chains: 12
Atoms: 3,506
Mol. weight: 56.96 kDa
Released: 20 Aug 2014

Explore 4QUF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QUF contains 21 α-helices and 31 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, D and E: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	23-25	3	1
β-strand	26-35	10	2
β-strand	38-45	8	2
α-helix	50-52	3
β-strand	54-57	4	2
α-helix	58-60	3
α-helix	62-64	3
α-helix	65-77	13

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	23-25	3	3
β-strand	26-35	10	4
β-strand	38-45	8	4
α-helix	50-52	3
β-strand	54-57	4	4
α-helix	58-60	3
α-helix	62-64	3
α-helix	65-83	19

Chain C: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	5
β-strand	26-35	10	6
β-strand	38-45	8	6
α-helix	50-52	3
β-strand	54-57	4	6
β-strand	63	1	5
α-helix	67-81	15

Chain F: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	10
β-strand	26-35	10	11
β-strand	38-45	8	11
α-helix	50-52	3
β-strand	54-57	4	11
α-helix	58-64	7
α-helix	65-79	15

Chains P, Q, T and V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-8	3	1

Chains R and U: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-7	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RE36324p	A, B, C, D, E, F	protein	68	Drosophila melanogaster	Q7JXA8 (AlphaFold model)
H3(1-15)K9me3 peptide	P, Q, R, T, U, V	protein	15		P02299 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>4QUF_1 RE36324p (chains A, B, C, D, E, F)
SDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFR
LHRKAAAK

Sequence of entity 2 (P, Q, R, T, U, V), FASTA

>4QUF_2 H3(1-15)K9me3 peptide (chains P, Q, R, T, U, V)
ARTKQTARKSTGGKA

Primary citation

Transgenerationally inherited piRNAs trigger piRNA biogenesis by changing the chromatin of piRNA clusters and inducing precursor processing. Le Thomas, A., Stuwe, E., Li, S. et al. Genes Dev (2014) 28:1667-1680. DOI 10.1101/gad.245514.114 · PubMed

Other PDB entries of the same protein (UniProt Q7JXA8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QUC 1.5 Å, Crystal structure of chromodomain of Rhino
4U68 1.8 Å, Crystal structure of Rhino chromodomain in complex with H3K9me3
5XYV 2.1 Å, Crystal structure of drosophila melanogaster Rhino chromoshadow domain in complex with…

Browse structure collections

About this viewer

MolViewer shows 4QUF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.