4QYL: Human BRPF1 bromodomain

Crystal Structure of the human BRPF1 bromodomain in complex with a histone H2AK5ac peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 24 Sept 2014.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 8
Atoms: 4,989
Mol. weight: 60.14 kDa
Released: 24 Sept 2014

Explore 4QYL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QYL contains 20 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-22	16
α-helix	40-43	4
α-helix	50-58	9
α-helix	65-82	18
α-helix	88-113	26

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-22	16
α-helix	40-43	4
α-helix	50-59	10
α-helix	65-82	18
α-helix	88-113	26

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-21	15
α-helix	40-43	4
α-helix	50-58	9
α-helix	65-82	18
α-helix	88-113	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peregrin	A, B, C, D	protein	117	Homo sapiens	P55201 (AlphaFold model)
Histone H2A type 1	E, F, G, H	protein	12	Homo sapiens	P0C0S8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4QYL_1 Peregrin (chains A, B, C, D)
GPLQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAY
RYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGID

Sequence of entity 2 (E, F, G, H), FASTA

>4QYL_2 Histone H2A type 1 (chains E, F, G, H)
SGRGKQGGKARA

Primary citation

Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain. Lubula, M.Y., Eckenroth, B.E., Carlson, S. et al. FEBS Lett (2014) 588:3844-3854. DOI 10.1016/j.febslet.2014.09.028 · PubMed

Other PDB entries of the same protein (UniProt P55201 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MWZ 1.25 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ073
3L42 1.3 Å, PWWP domain of human bromodomain and PHD finger containing protein 1
5C6S 1.3 Å, Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a
5FFV 1.3 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone…
5O5F 1.3 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ038
5ETB 1.33 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED13
5D7X 1.35 Å, Crystal structure of the human BRPF1 bromodomain in complex with XZ08
7C4I 1.37 Å, High resolution structure of BRPF1 Bromo Domain from Biortus
5EM3 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED9
5ETD 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED14
8QAZ 1.4 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…
8QB2 1.42 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…

Browse structure collections

About this viewer

MolViewer shows 4QYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.