Crystal structure of Plk1 Polo-box domain in complex with PL-2. Determined by X-ray diffraction at 1.6 Å resolution. Released 12 Nov 2014.
Explore 4RCP in 3D Show helices and sheets RCSB PDB PDBe
4RCP contains 9 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 374-386 | 13 | |
| α-helix | 397-400 | 4 | |
| β-strand | 401 | 1 | 1 |
| α-helix | 403-405 | 3 | |
| β-strand | 411-417 | 7 | 2 |
| β-strand | 422-427 | 6 | 2 |
| β-strand | 432-436 | 5 | 2 |
| β-strand | 441-444 | 4 | 2 |
| β-strand | 450-454 | 5 | 2 |
| β-strand | 460-464 | 5 | 2 |
| α-helix | 470-472 | 3 | |
| α-helix | 473-488 | 16 | |
| α-helix | 491-492 | 2 | |
| α-helix | 498-501 | 4 | |
| β-strand | 511-516 | 6 | 1 |
| β-strand | 520-525 | 6 | 1 |
| β-strand | 530-534 | 5 | 1 |
| β-strand | 540-544 | 5 | 1 |
| β-strand | 549-553 | 5 | 1 |
| β-strand | 559-563 | 5 | 1 |
| α-helix | 564-570 | 7 | |
| α-helix | 574-597 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase PLK1 | A | protein | 228 | Homo sapiens | P53350 (AlphaFold model) |
| PL-2 | B | protein | 5 |
>4RCP_1 Serine/threonine-protein kinase PLK1 (chains A) CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNS VGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLL KAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVT YIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNR
>4RCP_2 PL-2 (chains B) XHSTX
A new class of peptidomimetics targeting the polo-box domain of polo-like kinase 1. Ahn, M., Han, Y.H., Park, J.E. et al. J Med Chem (2015) 58:294-304. DOI 10.1021/jm501147g · PubMed
Other PDB entries of the same protein (UniProt P53350 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4RCP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.