Polo-like kinase I Polo-box domain in complex with FMPPPMSpSM phosphopeptide from TCERG1. Determined by X-ray diffraction at 1.4 Å resolution. Released 27 Apr 2011.
Explore 3Q1I in 3D Show helices and sheets RCSB PDB PDBe
3Q1I contains 7 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 374-386 | 13 | |
| α-helix | 397-400 | 4 | |
| β-strand | 401 | 1 | 1 |
| α-helix | 403-405 | 3 | |
| β-strand | 411-417 | 7 | 2 |
| β-strand | 422-427 | 6 | 2 |
| β-strand | 432-436 | 5 | 2 |
| β-strand | 441-444 | 4 | 2 |
| β-strand | 450-454 | 5 | 2 |
| β-strand | 460-464 | 5 | 2 |
| α-helix | 470-472 | 3 | |
| α-helix | 473-489 | 17 | |
| β-strand | 511-516 | 6 | 1 |
| β-strand | 520-525 | 6 | 1 |
| β-strand | 530-534 | 5 | 1 |
| β-strand | 540-544 | 5 | 1 |
| β-strand | 549-553 | 5 | 1 |
| β-strand | 559-563 | 5 | 1 |
| α-helix | 564-570 | 7 | |
| α-helix | 574-592 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 104 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase PLK1 | A | protein | 232 | Homo sapiens | P53350 (AlphaFold model) |
| peptide from Transcription elongation regulator 1 | E | protein | 11 | O14776 (AlphaFold model) |
>3Q1I_1 Serine/threonine-protein kinase PLK1 (chains A) GPLGSPEFDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYG LGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYF RNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLI LCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
>3Q1I_2 peptide from Transcription elongation regulator 1 (chains E) XFMPPPMSSMX
| ID | Name | Formula | Copies |
|---|---|---|---|
| PG0 | 2-(2-methoxyethoxy)ethanol | C5 H12 O3 | 1 |
Water and common crystallization additives (1PE, PEG) are not listed.
From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1. Sledz, P., Stubbs, C.J., Lang, S. et al. Angew Chem Int Ed Engl (2011) 50:4003-4006. DOI 10.1002/anie.201008019 · PubMed
Other PDB entries of the same protein (UniProt P53350 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3Q1I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.