4RML: Latrophilin-3

Crystal structure of the Olfactomedin domain of latrophilin 3 in C2221 crystal form. Determined by X-ray diffraction at 1.6 Å resolution. Released 19 Aug 2015.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Mus musculus
Chains: 1
Atoms: 2,294
Mol. weight: 36.78 kDa
Ligands: MG
Released: 19 Aug 2015

Explore 4RML in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RML contains 5 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	201-203	3
β-strand	206-218	13	1
β-strand	224-227	4	2
β-strand	237-241	5	2
β-strand	249-253	5	2
α-helix	256-261	6
β-strand	266-269	4	2
α-helix	273	1
β-strand	274	1	3
β-strand	280-282	3	4
β-strand	285-289	5	4
β-strand	290	1	3
β-strand	295-300	6	4
β-strand	305-311	7	4
β-strand	315	1	5
β-strand	332-336	5	6
β-strand	339-345	7	6
β-strand	346	1	5
β-strand	352-358	7	6
β-strand	365-374	10	6
α-helix	375-377	3
β-strand	378-384	7	7
β-strand	387-393	7	7
β-strand	405-412	8	7
β-strand	417-424	8	7
α-helix	425-426	2
β-strand	434-438	5	1
β-strand	443-448	6	1
β-strand	451-460	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Latrophilin-3	A	protein	321	Mus musculus	Q80TS3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4RML_1 Latrophilin-3 (chains A)
APSTDHLDYKDDDDKAAAKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYM
PWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFD
LRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNP
YTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSL
VDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGPVHHGQVSYISPP
IHLDSELERPPVRGILEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (TRS) are not listed.

Primary citation

Structural and Mechanistic Insights into the Latrophilin3-FLRT3 Complex that Mediates Glutamatergic Synapse Development. Ranaivoson, F.M., Liu, Q., Martini, F. et al. Structure (2015) 23:1665-1677. DOI 10.1016/j.str.2015.06.022 · PubMed

Other PDB entries of the same protein (UniProt Q80TS3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RMK 1.61 Å, Crystal structure of the Olfactomedin domain of latrophilin 3 in P65 crystal form
6JBU 1.85 Å, High resolution crystal structure of human FLRT3 LRR domain in complex with mouse CIRL3…
7WY5 2.83 Å, ADGRL3/Gq complex
7WY8 2.83 Å, ADGRL3/Gs complex
7X10 2.93 Å, ADGRL3/miniG12 complex
7WYB 2.97 Å, ADGRL3/Gi complex
4YEB 3.19 Å, Structural characterization of a synaptic adhesion complex
5FTT 3.4 Å, Octameric complex of Latrophilin 3 (Lec, Olf) , Unc5D (Ig, Ig2, TSP1) and FLRT2 (LRR)
5FTU 6.01 Å, Tetrameric complex of Latrophilin 3, Unc5D and FLRT2

Browse structure collections

About this viewer

MolViewer shows 4RML directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.