4RTW: C-Src-SH3 domain E93V/Q128R mutant

Crystal structure of the c-Src-SH3 domain E93V/Q128R mutant in complex with the high affinity peptide APP12. Determined by X-ray diffraction at 1.24 Å resolution. Released 28 Oct 2015.

Method: X-ray diffraction
Resolution: 1.24 Å
Organism: Gallus gallus
Chains: 5
Atoms: 1,336
Mol. weight: 18.52 kDa
Released: 28 Oct 2015

Explore 4RTW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RTW contains 5 α-helices and 16 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	86-88	3	1
β-strand	92	1	2
β-strand	99	1	1
β-strand	102	1	2
β-strand	107-115	9	1
β-strand	118-123	6	1
β-strand	129-133	5	1
α-helix	134-136	3
β-strand	137-139	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5

Chain C: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	86-88	3	3
β-strand	92	1	4
β-strand	99	1	3
β-strand	102	1	4
β-strand	107-112	6	3
β-strand	118-123	6	3
β-strand	129-133	5	3
α-helix	134-136	3
β-strand	137-139	3	3

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene tyrosine-protein kinase Src	A, C	protein	61	Gallus gallus	P00523 (AlphaFold model)
APP12 peptide	B, D, E	protein	13

Sequence of entity 1 (A, C), FASTA

>4RTW_1 Proto-oncogene tyrosine-protein kinase Src (chains A, C)
GSHMTFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
D

Sequence of entity 2 (B, D, E), FASTA

>4RTW_2 APP12 peptide (chains B, D, E)
XAPPLPPRNRPRL

Primary citation

Crystal structure of the c-Src-SH3 domain E93V/Q128R mutant in complex with the high affinity peptide APP12. Camara-Artigas, A. To be published.

Other PDB entries of the same protein (UniProt P00523 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XVM 0.9 Å, Crystal structure of c-Src SH3 domain without ATCUN motif: monomer 2
7A31 0.94 Å, Crystal structure of the c-Src SH3 domain mutant S94A-T98D-V111L-N113S-T114S at pH 4.5
5OAV 0.95 Å, High resolution crystal structure of the c-Src-SH3 domain mutant E93V in complex with…
7A33 0.96 Å, Crystal structure of the c-Src SH3 domain mutant S94A-T98D-V111L-N113S-T114S at pH 3.0
4RTZ 0.98 Å, Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide VSL12
4HVU 0.98 Å, Crystal structure of the T98D c-Src-SH3 domain mutant in complex with the high affinity…
4HVW 0.98 Å, Crystal structure of the T98E c-Src-SH3 domain mutant in complex with the high affinity…
4OMO 1.04 Å, Crystal structure of the c-Src tyrosine kinase SH3 domain mutant Q128E
6XX4 1.05 Å, Crystal structure of the c-Src SH3 domain H122R-Q128E mutant in complex with Ni(II) at…
4HVV 1.1 Å, Crystal structure of the T98E c-Src-SH3 domain mutant in complex with the high affinity…
7A32 1.15 Å, Crystal structure of the c-Src SH3 domain mutant S94A-T98D-V111L-N113S-T114S at pH 7.0
5ECA 1.16 Å, Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from…

Browse structure collections

About this viewer

MolViewer shows 4RTW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.