4UDD: Glucocorticoid receptor

GR in complex with desisobutyrylciclesonide. Determined by X-ray diffraction at 1.8 Å resolution. Released 25 Nov 2015.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,580
Mol. weight: 36.27 kDa
Ligands: CV7, CPS
Released: 25 Nov 2015

Explore 4UDD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UDD contains 14 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	532-538	7
α-helix	540-545	6
α-helix	553-554	2
α-helix	556-579	24
α-helix	584-586	3
α-helix	589-615	27
β-strand	621-624	4	1
β-strand	627-629	3	1
α-helix	631-634	4
α-helix	639-655	17
α-helix	660-671	12
β-strand	674-675	2	2
α-helix	683-702	20
α-helix	708-741	34
α-helix	743-745	3
α-helix	751-765	15
β-strand	770-771	2	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	743-750	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucocorticoid receptor	A	protein	280	HOMO SAPIENS	P04150 (AlphaFold model)
Nuclear receptor coactivator 2	B	protein	14	HOMO SAPIENS	Q15596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4UDD_1 GLUCOCORTICOID RECEPTOR (chains A)
GSIQQATTGVSQETSENPGDKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTW
RIMTTLNMLGGRQMIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSS
ANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPK
DGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCF
QTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Sequence of entity 2 (B), FASTA

>4UDD_2 NUCLEAR RECEPTOR COACTIVATOR 2 (chains B)
KENALLRYLLDKDD

Ligands and cofactors

ID	Name	Formula	Copies
CV7	Desisobuytyryl ciclesonide	C28 H38 O6	1
CPS	3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate	C32 H58 N2 O7 S	3

Water and common crystallization additives (EDO) are not listed.

Primary citation

Ligand Binding Mechanism in Steroid Receptors: From Conserved Plasticity to Differential Evolutionary Constraints. Edman, K., Hosseini, A., Bjursell, M.K. et al. Structure (2015) 23:2280. DOI 10.1016/J.STR.2015.09.012 · PubMed

Other PDB entries of the same protein (UniProt P04150 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E69 1.85 Å, Glucocorticoid receptor DNA binding domain - IL8 NF-kB response element complex
4HN5 1.9 Å, GR DNA Binding Domain - TSLP nGRE Complex
4P6W 1.95 Å, Crystal Structure of mometasone furoate-bound glucocorticoid receptor ligand binding…
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
5CBY 2.0 Å, AncGR2 DNA Binding Domain - (+)GRE Complex
5CBX 2.0 Å, AncGR DNA Binding Domain - (+)GRE Complex
6X6E 2.0 Å, Glucocorticoid Receptor DNA binding domain in complex with methylated precursor for a…
5UC3 2.01 Å, Structure of the dominant negative mutant Glucocorticoid Receptor alpha (L733K/N734P)…
6YMO 2.02 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pS617 peptide
6YO8 2.09 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pT524 peptide
3K22 2.1 Å, Glucocorticoid Receptor with Bound alaninamide 10 with TIF2 peptide
5NFP 2.1 Å, Glucocorticoid Receptor in complex with budesonide

Browse structure collections

About this viewer

MolViewer shows 4UDD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.